StarFunc result for job id Q9Y639

User Input

>input (398 residues)
MSGSSLPSALALSLLLVSGSLLPGPGAAQNAGFVKSPMSETKLTGDAFELYCDVVGSPTP
EIQWWYAEVNRAESFRQLWDGARKRRVTVNTAYGSNGVSVLRITRLTLEDSGTYECRASN
DPKRNDLRQNPSITWIRAQATISVLQKPRIVTSEEVIIRDSPVLPVTLQCNLTSSSHTLT
YSYWTKNGVELSATRKNASNMEYRINKPRAEDSGEYHCVYHFVSAPKANATIEVKAAPDI
TGHKRSENKNEGQDATMYCKSVGYPHPDWIWRKKENGMPMDIVNTSGRFFIINKENYTEL
NIVNLQITEDPGEYECNATNAIGSASVVTVLRVRSHLAPLWPFLGILAEIIILVVIIVVY
EKRKRPDEVPDDDEPAGPMKTNSTNNHKDKNLRQRNTN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y639	1.000	1.000	5.128E-72	398	1.000	1.000	Q9Y639.pdb.gz	NPTN_HUMAN Neuroplastin OS=Homo sapiens OX=9606 GN=NPTN PE=1 SV=2
2	AFDB:Q6NZV3	0.745	0.736	2.277E-57	403	0.673	0.665	Q6NZV3.pdb.gz	Q6NZV3_DANRE Neuroplastin precursor OS=Danio rerio OX=7955 GN=zgc:77326 PE=1 SV=1
3	AFDB:P17790	0.663	0.678	2.304E-40	388	0.437	0.448	P17790.pdb.gz	BASI_CHICK Basigin OS=Gallus gallus OX=9031 GN=BSG PE=1 SV=2
4	AFDB:P18572	0.466	0.475	1.210E-39	389	0.412	0.422	P18572.pdb.gz	BASI_MOUSE Basigin OS=Mus musculus OX=10090 GN=Bsg PE=1 SV=2
5	AFDB:P35613	0.408	0.419	5.198E-39	385	0.397	0.410	P35613.pdb.gz	BASI_HUMAN Basigin OS=Homo sapiens OX=9606 GN=BSG PE=1 SV=2
6	AFDB:P26453	0.415	0.424	1.351E-38	388	0.410	0.420	P26453.pdb.gz	BASI_RAT Basigin OS=Rattus norvegicus OX=10116 GN=Bsg PE=1 SV=2
7	AFDB:Q08CP9	0.560	0.647	5.504E-33	343	0.422	0.490	Q08CP9.pdb.gz
8	AFDB:Q86TC9	0.239	0.076	1.437E-21	1320	0.173	0.052	Q86TC9.pdb.gz	MYPN_HUMAN Myopalladin OS=Homo sapiens OX=9606 GN=MYPN PE=1 SV=2
9	AFDB:Q5DTJ9	0.233	0.076	5.308E-21	1315	0.168	0.051	Q5DTJ9.pdb.gz	MYPN_MOUSE Myopalladin OS=Mus musculus OX=10090 GN=Mypn PE=1 SV=2
10	AFDB:Q9VMN9	0.331	0.299	1.525E-20	450	0.188	0.167	Q9VMN9.pdb.gz	Q9VMN9_DROME Dpr-interacting protein eta, isoform B OS=Drosophila melanogaster OX=7227 GN=DIP-eta PE=1 SV=4
11	PDB:6dldD	0.304	0.414	7.527E-14	269	0.158	0.234	6dldD.pdb.gz
12	PDB:5oj2B	0.197	0.129	1.600E-13	692	0.158	0.091	5oj2B.pdb.gz
13	PDB:1e07A	0.289	0.194	6.274E-12	642	0.111	0.069	1e07A.pdb.gz
14	PDB:6dlfA	0.244	0.378	7.745E-11	236	0.126	0.212	6dlfA.pdb.gz
15	PDB:5c6wJ	0.214	0.348	8.564E-11	238	0.128	0.214	5c6wJ.pdb.gz
16	PDB:6feyB	0.224	0.418	5.281E-9	207	0.128	0.246	6feyB.pdb.gz	Structures of insect Imp-L2 suggest an alternative strategy for regulating the bioavailability of insulin-like hormones.
17	PDB:7sqcO0	0.215	0.102	1.241E-8	1140	0.080	0.028	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
18	PDB:1hzhH	0.218	0.193	7.970E-8	457	0.118	0.103	1hzhH.pdb.gz	Crystal structure of a neutralizing human IGG against HIV-1: a template for vaccine design.
19	PDB:5c7kF	0.224	0.398	1.532E-7	212	0.080	0.151	5c7kF.pdb.gz	Complete epitopes for vaccine design derived from a crystal structure of the broadly neutralizing antibodies PGT128 and 8ANC195 in complex with an HIV-1 Env trimer.
20	PDB:1igaA	0.209	0.178	2.178E-7	475	0.098	0.082	1igaA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P97300	0.0	726	397	0.952	0.955	NPTN_MOUSE Neuroplastin OS=Mus musculus OX=10090 GN=Nptn PE=1 SV=3
2	P97546	0.0	717	393	0.950	0.962	NPTN_RAT Neuroplastin OS=Rattus norvegicus OX=10116 GN=Nptn PE=1 SV=2
3	Q6NZV3	0.0	546	403	0.671	0.663	Q6NZV3_DANRE Neuroplastin precursor OS=Danio rerio OX=7955 GN=zgc:77326 PE=1 SV=1
4	Q9Y639	0.0	826	398	1.000	1.000	NPTN_HUMAN Neuroplastin OS=Homo sapiens OX=9606 GN=NPTN PE=1 SV=2
5	A4IGC1	5.31e-116	341	277	0.425	0.610	A4IGC1_DANRE Neuroplastin a OS=Danio rerio OX=7955 GN=sb:cb578 PE=1 SV=1
6	P17790	3.43e-108	325	388	0.445	0.456	BASI_CHICK Basigin OS=Gallus gallus OX=9031 GN=BSG PE=1 SV=2
7	P35613	1.26e-101	308	385	0.410	0.423	BASI_HUMAN Basigin OS=Homo sapiens OX=9606 GN=BSG PE=1 SV=2
8	P26453	3.71e-95	291	388	0.412	0.423	BASI_RAT Basigin OS=Rattus norvegicus OX=10116 GN=Bsg PE=1 SV=2
9	P18572	2.12e-94	290	389	0.405	0.414	BASI_MOUSE Basigin OS=Mus musculus OX=10090 GN=Bsg PE=1 SV=2
10	A0A0M5L610	1.26e-52	178	269	0.239	0.353	A0A0M5L610_PANTR Basigin OS=Pan troglodytes OX=9598 GN=BSG PE=1 SV=1
11	O55108	6.11e-48	166	257	0.244	0.377	O55108_MOUSE Basigin (Fragment) OS=Mus musculus OX=10090 GN=Bsg PE=1 SV=1
12	Q3UQ28	4.38e-18	89.0	1475	0.231	0.062	PXDN_MOUSE Peroxidasin homolog OS=Mus musculus OX=10090 GN=Pxdn PE=1 SV=2
13	Q8WZ42	3.90e-17	86.3	34350	0.209	0.002	TITIN_HUMAN Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 SV=4
14	Q92626	1.72e-16	84.0	1479	0.224	0.060	PXDN_HUMAN Peroxidasin homolog OS=Homo sapiens OX=9606 GN=PXDN PE=1 SV=2
15	A2ASS6	3.81e-16	83.2	35213	0.198	0.002	TITIN_MOUSE Titin OS=Mus musculus OX=10090 GN=Ttn PE=1 SV=1
16	Q9GPP7	1.27e-15	81.3	1406	0.201	0.057	Q9GPP7_DROME Roundabout 2 OS=Drosophila melanogaster OX=7227 GN=robo2 PE=2 SV=1
17	Q7TN00	1.33e-15	81.6	3410	0.193	0.023	Q7TN00_RAT Cardiac titin N2BA isoform (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=2
18	Q9VQ08	1.35e-15	81.3	1463	0.201	0.055	Q9VQ08_DROME FI23903p1 OS=Drosophila melanogaster OX=7227 GN=robo2 PE=2 SV=2
19	M9PC46	1.50e-15	81.3	1519	0.204	0.053	M9PC46_DROME Roundabout 2, isoform B OS=Drosophila melanogaster OX=7227 GN=robo2 PE=4 SV=1
20	A0A8I5ZUN3	2.06e-15	80.9	35375	0.193	0.002	A0A8I5ZUN3_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05790 C2-set	24	16.5	Immunoglobulin C2-set domain
2	PF07679 I-set	2.6e-24	96.4	Immunoglobulin I-set domain
3	PF00047 ig	4.6e-19	79.7	Immunoglobulin domain
4	PF13895 Ig_2	1.3e-16	72.0	Immunoglobulin domain
5	PF13927 Ig_3	2e-30	116.5	Immunoglobulin domain
6	PF16680 Ig_4	0.0055	28.6	T-cell surface glycoprotein CD3 delta chain
7	PF16681 Ig_5	0.042	25.6	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
8	PF17736 Ig_C17orf99	4.7	18.7	C17orf99 Ig domain
9	PF16706 Izumo-Ig	32	15.9	Izumo-like Immunoglobulin domain
10	PF07686 V-set	1.1e-09	49.8	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000010163

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000003080	0.799	Receptor for erythropoietin
2	60711.ENSCSAP00000004340	0.715	Cell surface proteoglycan
3	60711.ENSCSAP00000007138	0.687	May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity
4	60711.ENSCSAP00000000135	0.677	This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium.
5	60711.ENSCSAP00000008262	0.658	IQ motif and Sec7 domain 3
6	60711.ENSCSAP00000003580	0.630	Prolactin-induced protein
7	60711.ENSCSAP00000009673	0.605	Peptidylprolyl isomerase (cyclophilin)-like 2
8	60711.ENSCSAP00000000184	0.581	Belongs to the integrin beta chain family.
9	60711.ENSCSAP00000007617	0.581	Integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12)
10	60711.ENSCSAP00000003763	0.569	Integrin, beta 2 (complement component 3 receptor 3 and 4 subunit)
11	60711.ENSCSAP00000015311	0.565	ORMDL sphingolipid biosynthesis regulator 3
12	60711.ENSCSAP00000003252	0.560	Limbic system-associated membrane protein
13	60711.ENSCSAP00000014773	0.551	annotation not available
14	60711.ENSCSAP00000018280	0.551	Prion protein
15	60711.ENSCSAP00000010734	0.532	PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides
16	60711.ENSCSAP00000017751	0.532	PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides
17	60711.ENSCSAP00000001839	0.530	Belongs to the integrin beta chain family.
18	60711.ENSCSAP00000011776	0.530	Belongs to the integrin beta chain family.
19	60711.ENSCSAP00000013959	0.525	Hormone involved in the regulation of erythrocyte proliferation and differentiation and the maintenance of a physiological level of circulating erythrocyte mass. Binds to EPOR leading to EPOR dimerization and JAK2 activation thereby activating specific downstream effectors, including STAT1 and STAT3.
20	60711.ENSCSAP00000015892	0.512	Solute carrier family 16 (monocarboxylate transporter), member 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0042802	0.501	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0009987	0.993	cellular process
GO:0023051	0.971	regulation of signaling
GO:0010646	0.970	regulation of cell communication
GO:0050896	0.957	response to stimulus
GO:0032502	0.948	developmental process
GO:0032501	0.939	multicellular organismal process
GO:0099177	0.934	regulation of trans-synaptic signaling
GO:0019222	0.889	regulation of metabolic process
GO:0071840	0.888	cellular component organization or biogenesis
GO:0016043	0.871	cellular component organization
GO:0060255	0.845	regulation of macromolecule metabolic process
GO:0048518	0.832	positive regulation of biological process
GO:0051239	0.797	regulation of multicellular organismal process
GO:0048856	0.783	anatomical structure development
GO:0023052	0.716	signaling
GO:0007154	0.715	cell communication
GO:0032879	0.710	regulation of localization
GO:0048519	0.708	negative regulation of biological process
GO:0065008	0.688	regulation of biological quality
GO:0010468	0.682	regulation of gene expression
GO:0048522	0.664	positive regulation of cellular process
GO:0009892	0.660	negative regulation of metabolic process
GO:0007275	0.601	multicellular organism development
GO:0010605	0.540	negative regulation of macromolecule metabolic process
GO:0050804	0.536	modulation of chemical synaptic transmission
GO:0001817	0.527	regulation of cytokine production
GO:0034330	0.478	cell junction organization
GO:0048731	0.465	system development
GO:0042592	0.456	homeostatic process
GO:0007165	0.415	signal transduction
GO:0009893	0.394	positive regulation of metabolic process
GO:0080090	0.357	regulation of primary metabolic process
GO:0051171	0.357	regulation of nitrogen compound metabolic process
GO:0031323	0.357	regulation of cellular metabolic process
GO:0048583	0.322	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0043231	0.742	intracellular membrane-bounded organelle
GO:0009986	0.590	cell surface
GO:0005737	0.563	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]