StarFunc result for job id Q9Y644

User Input

>input (331 residues)
MSRARGALCRACLALAAALAALLLLPLPLPRAPAPARTPAPAPRAPPSRPAAPSLRPDDV
FIAVKTTRKNHGPRLRLLLRTWISRARQQTFIFTDGDDPELELQGGDRVINTNCSAVRTR
QALCCKMSVEYDKFIESGRKWFCHVDDDNYVNARSLLHLLSSFSPSQDVYLGRPSLDHPI
EATERVQGGRTVTTVKFWFATGGAGFCLSRGLALKMSPWASLGSFMSTAEQVRLPDDCTV
GYIVEGLLGARLLHSPLFHSHLENLQRLPPDTLLQQVTLSHGGPENPHNVVNVAGGFSLH
QDPTRFKSIHCLLYPDTDWCPRQKQGAPTSR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9R1U9	0.827	0.820	1.407E-59	334	0.810	0.802	Q9R1U9.pdb.gz	RFNG_RAT Beta-1,3-N-acetylglucosaminyltransferase radical fringe OS=Rattus norvegicus OX=10116 GN=Rfng PE=2 SV=1
2	AFDB:Q6KFX9	0.825	0.755	2.917E-51	362	0.625	0.572	Q6KFX9.pdb.gz	RFNG_DANRE Beta-1,3-N-acetylglucosaminyltransferase radical fringe OS=Danio rerio OX=7955 GN=rfng PE=2 SV=1
3	AFDB:Q8JHF2	0.799	0.709	3.030E-46	374	0.547	0.484	Q8JHF2.pdb.gz	LFNG_DANRE Beta-1,3-N-acetylglucosaminyltransferase lunatic fringe OS=Danio rerio OX=7955 GN=lfng PE=2 SV=2
4	AFDB:O09010	0.799	0.702	4.106E-46	378	0.604	0.529	O09010.pdb.gz	LFNG_MOUSE Beta-1,3-N-acetylglucosaminyltransferase lunatic fringe OS=Mus musculus OX=10090 GN=Lfng PE=1 SV=1
5	AFDB:O00587	0.817	0.842	2.253E-45	321	0.508	0.523	O00587.pdb.gz	MFNG_HUMAN Beta-1,3-N-acetylglucosaminyltransferase manic fringe OS=Homo sapiens OX=9606 GN=MFNG PE=1 SV=2
6	AFDB:Q8NES3	0.792	0.692	2.544E-45	379	0.616	0.538	Q8NES3.pdb.gz	LFNG_HUMAN Beta-1,3-N-acetylglucosaminyltransferase lunatic fringe OS=Homo sapiens OX=9606 GN=LFNG PE=1 SV=2
7	AFDB:O09008	0.803	0.827	7.315E-42	321	0.480	0.495	O09008.pdb.gz	MFNG_MOUSE Beta-1,3-N-acetylglucosaminyltransferase manic fringe OS=Mus musculus OX=10090 GN=Mfng PE=1 SV=1
8	AFDB:Q24342	0.794	0.641	1.552E-38	412	0.402	0.323	Q24342.pdb.gz	FNG_DROME Fringe glycosyltransferase OS=Drosophila melanogaster OX=7227 GN=fng PE=1 SV=1
9	AFDB:Q5DTK1	0.496	0.202	3.073E-12	884	0.196	0.074	Q5DTK1.pdb.gz	CHSS3_MOUSE Chondroitin sulfate synthase 3 OS=Mus musculus OX=10090 GN=Chsy3 PE=2 SV=3
10	AFDB:A0A068F9P7	0.519	0.355	3.266E-12	496	0.175	0.117	A0A068F9P7.pdb.gz	A0A068F9P7_DANRE Beta-1,3-glucosyltransferase OS=Danio rerio OX=7955 GN=b3galtla PE=2 SV=1
11	PDB:7jhiC	0.462	0.462	5.147E-9	331	0.148	0.148	7jhiC.pdb.gz	Structures and mechanism of human glycosyltransferase beta 1,3-N-acetylglucosaminyltransferase 2 (B3GNT2), an important player in immune homeostasis.
12	PDB:4fixA	0.348	0.198	2.718E-5	629	0.097	0.051	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.
13	PDB:6fxrA	0.320	0.171	4.733E-4	700	0.094	0.044	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.
14	PDB:3k8dA	0.329	0.421	1.697E-3	246	0.088	0.118	3k8dA.pdb.gz	Structure-based mechanism of CMP-2-keto-3-deoxymanno-octulonic acid synthetase: convergent evolution of a sugar-activating enzyme with DNA/RNA polymerases
15	PDB:4j18A	0.276	0.203	1.916E-3	485	0.057	0.039	4j18A.pdb.gz
16	PDB:7sckA	0.304	0.181	1.916E-3	642	0.106	0.055	7sckA.pdb.gz	Structural basis for heparan sulfate co-polymerase action by the EXT1-2 complex.
17	PDB:4y63A	0.332	0.376	2.443E-3	282	0.103	0.121	4y63A.pdb.gz	Design of Glycosyltransferase Inhibitors: Serine Analogues as Pyrophosphate Surrogates?
18	PDB:4cvhA	0.353	0.310	3.740E-3	391	0.085	0.072	4cvhA.pdb.gz	Human Ispd is a Cytidyltransferase Required for Dystroglycan O-Mannosylation.
19	PDB:7d72A	0.313	0.266	5.386E-3	407	0.088	0.071	7d72A.pdb.gz	Cryo-EM structures of human GMPPA-GMPPB complex reveal how cells maintain GDP-mannose homeostasis.
20	PDB:1h5sB	0.313	0.346	5.723E-3	291	0.085	0.096	1h5sB.pdb.gz	Kinetic and crystallographic analyses support a sequential-ordered bi bi catalytic mechanism for Escherichia coli glucose-1-phosphate thymidylyltransferase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9R1U9	0.0	509	334	0.807	0.799	RFNG_RAT Beta-1,3-N-acetylglucosaminyltransferase radical fringe OS=Rattus norvegicus OX=10116 GN=Rfng PE=2 SV=1
2	O09009	1.10e-179	501	332	0.710	0.708	RFNG_MOUSE Beta-1,3-N-acetylglucosaminyltransferase radical fringe OS=Mus musculus OX=10090 GN=Rfng PE=2 SV=1
3	Q6KFX9	9.54e-142	407	362	0.653	0.597	RFNG_DANRE Beta-1,3-N-acetylglucosaminyltransferase radical fringe OS=Danio rerio OX=7955 GN=rfng PE=2 SV=1
4	Q8JHF2	2.14e-139	401	374	0.556	0.492	LFNG_DANRE Beta-1,3-N-acetylglucosaminyltransferase lunatic fringe OS=Danio rerio OX=7955 GN=lfng PE=2 SV=2
5	Q8NES3	9.03e-126	367	379	0.559	0.488	LFNG_HUMAN Beta-1,3-N-acetylglucosaminyltransferase lunatic fringe OS=Homo sapiens OX=9606 GN=LFNG PE=1 SV=2
6	O09010	1.52e-124	363	378	0.547	0.479	LFNG_MOUSE Beta-1,3-N-acetylglucosaminyltransferase lunatic fringe OS=Mus musculus OX=10090 GN=Lfng PE=1 SV=1
7	O00587	4.79e-110	325	321	0.486	0.502	MFNG_HUMAN Beta-1,3-N-acetylglucosaminyltransferase manic fringe OS=Homo sapiens OX=9606 GN=MFNG PE=1 SV=2
8	O09008	8.41e-109	322	321	0.514	0.530	MFNG_MOUSE Beta-1,3-N-acetylglucosaminyltransferase manic fringe OS=Mus musculus OX=10090 GN=Mfng PE=1 SV=1
9	Q24342	3.23e-91	280	412	0.408	0.328	FNG_DROME Fringe glycosyltransferase OS=Drosophila melanogaster OX=7227 GN=fng PE=1 SV=1
10	Q6Y288	1.43e-10	64.3	498	0.193	0.129	B3GLT_HUMAN Beta-1,3-glucosyltransferase OS=Homo sapiens OX=9606 GN=B3GLCT PE=1 SV=2
11	A0A068F9P7	1.55e-06	52.0	496	0.187	0.125	A0A068F9P7_DANRE Beta-1,3-glucosyltransferase OS=Danio rerio OX=7955 GN=b3galtla PE=2 SV=1
12	A0A068F5P3	4.09e-06	50.4	493	0.190	0.128	A0A068F5P3_DANRE Beta-1,3-glucosyltransferase precursor OS=Danio rerio OX=7955 GN=si:dkey-189i22.3 PE=2 SV=1
13	Q9W0L4	1.88e-05	48.1	341	0.136	0.132	Q9W0L4_DROME IP12857p OS=Drosophila melanogaster OX=7227 GN=dC1GalT6 PE=2 SV=2
14	Q9VQH6	3.26e-05	47.8	385	0.157	0.135	Q9VQH6_DROME Uncharacterized protein OS=Drosophila melanogaster OX=7227 GN=Dmel\CG2975 PE=4 SV=1
15	Q9JJ06	3.77e-05	47.4	363	0.115	0.105	C1GLT_MOUSE Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=C1galt1 PE=1 SV=1
16	Q70JA7	6.19e-05	47.0	882	0.172	0.065	CHSS3_HUMAN Chondroitin sulfate synthase 3 OS=Homo sapiens OX=9606 GN=CHSY3 PE=2 SV=3
17	Q7K237	1.39e-04	45.4	388	0.121	0.103	C1GLT_DROME Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Drosophila melanogaster OX=7227 GN=C1GalTA PE=1 SV=1
18	Q7Z1Z1	1.63e-04	45.8	736	0.166	0.075	CHSSA_CAEEL Chondroitin sulfate synthase sqv-5 OS=Caenorhabditis elegans OX=6239 GN=sqv-5 PE=1 SV=1
19	Q6ZQ11	3.58e-04	44.7	800	0.181	0.075	CHSS1_MOUSE Chondroitin sulfate synthase 1 OS=Mus musculus OX=10090 GN=Chsy1 PE=2 SV=2
20	Q5DTK1	5.14e-04	44.3	884	0.166	0.062	CHSS3_MOUSE Chondroitin sulfate synthase 3 OS=Mus musculus OX=10090 GN=Chsy3 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02434 Fringe	7.3e-111	381.2	Fringe-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000307971

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000277541	0.971	Neurogenic locus notch homolog protein 1
2	9606.ENSP00000263388	0.957	Neurogenic locus notch homolog protein 3
3	9606.ENSP00000256646	0.953	Neurogenic locus notch homolog protein 2
4	9606.ENSP00000364163	0.934	Neurogenic locus notch homolog protein 4
5	9606.ENSP00000222725	0.811	Beta-1,3-N-acetylglucosaminyltransferase lunatic fringe
6	9606.ENSP00000349490	0.810	Beta-1,3-N-acetylglucosaminyltransferase manic fringe
7	9606.ENSP00000254958	0.734	Protein jagged-1
8	9606.ENSP00000364902	0.716	GDP-fucose protein O-fucosyltransferase 1
9	9606.ENSP00000328169	0.704	Protein jagged-2
10	9606.ENSP00000316173	0.658	Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase
11	9606.ENSP00000362456	0.625	Protein PBDC1
12	9606.ENSP00000269159	0.611	Inositol monophosphatase 2
13	9606.ENSP00000360421	0.610	Leucine-rich repeat-containing protein 42
14	9606.ENSP00000355718	0.594	Delta-like protein 1
15	9606.ENSP00000295588	0.585	Protein O-glucosyltransferase 1
16	9606.ENSP00000338207	0.581	Rhombotin-1
17	9606.ENSP00000374268	0.545	Glucoside xylosyltransferase 2
18	9606.ENSP00000381666	0.541	Glucoside xylosyltransferase 1
19	9606.ENSP00000309640	0.526	Xyloside xylosyltransferase 1
20	9606.ENSP00000362717	0.519	LIM/homeobox protein Lhx2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008375	1.000	acetylglucosaminyltransferase activity
GO:0005515	0.919	protein binding
GO:0033829	0.836	O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.983	biological regulation
GO:0050789	0.957	regulation of biological process
GO:0050794	0.918	regulation of cellular process
GO:0008593	0.851	regulation of Notch signaling pathway
GO:0009987	0.620	cellular process
GO:0032502	0.478	developmental process
GO:0048856	0.469	anatomical structure development
GO:0032501	0.418	multicellular organismal process
GO:0048518	0.315	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005794	0.995	Golgi apparatus
GO:0031090	0.987	organelle membrane
GO:0098588	0.973	bounding membrane of organelle
GO:0005576	0.961	extracellular region
GO:0000139	0.920	Golgi membrane
GO:0070013	0.377	intracellular organelle lumen
GO:0005615	0.333	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.
EC:2.4.1.222	0.836	O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase.

[back to server]