StarFunc result for job id Q9Y657

User Input

>input (262 residues)
MKTPFGKTPGQRSRADAGHAGVSANMMKKRTSHKKHRSSVGPSKPVSQPRRNIVGCRIQH
GWKEGNGPVTQWKGTVLDQVPVNPSLYLIKYDGFDCVYGLELNKDERVSALEVLPDRVAT
SRISDAHLADTMIGKAVEHMFETEDGSKDEWRGMVLARAPVMNTWFYITYEKDPVLYMYQ
LLDDYKEGDLRIMPDSNDSPPAEREPGEVVDSLVGKQVEYAKEDGSKRTGMVIHQVEAKP
SVYFIKFDDDFHIYVYDLVKTS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R297	0.825	0.825	7.008E-47	262	1.000	1.000	A0A024R297.pdb.gz
2	AFDB:Q5JUX0	0.829	0.841	1.376E-41	258	0.832	0.845	Q5JUX0.pdb.gz	SPIN3_HUMAN Spindlin-3 OS=Homo sapiens OX=9606 GN=SPIN3 PE=1 SV=1
3	AFDB:A0A024R9W1	0.815	0.827	1.622E-39	258	0.767	0.779	A0A024R9W1.pdb.gz
4	AFDB:Q56A73	0.777	0.817	4.130E-36	249	0.702	0.739	Q56A73.pdb.gz	SPIN4_HUMAN Spindlin-4 OS=Homo sapiens OX=9606 GN=SPIN4 PE=1 SV=1
5	PDB:2ns2A	0.743	0.964	6.099E-36	201	0.767	1.000	2ns2A.pdb.gz	Structure of human spindlin1. Tandem tudor-like domains for cell cycle regulation
6	PDB:2ns2B	0.647	0.980	5.009E-30	172	0.656	1.000	2ns2B.pdb.gz	Structure of human spindlin1. Tandem tudor-like domains for cell cycle regulation
7	AFDB:A0A087X074	0.256	0.406	8.008E-15	157	0.458	0.764	A0A087X074.pdb.gz	A0A087X074_HUMAN Spindlin family member 2A OS=Homo sapiens OX=9606 GN=SPIN2A PE=3 SV=1
8	AFDB:O35413	0.154	0.046	9.627E-5	1196	0.145	0.032	O35413.pdb.gz	SRBS2_RAT Sorbin and SH3 domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Sorbs2 PE=1 SV=2
9	AFDB:O60504	0.159	0.075	2.572E-3	671	0.134	0.052	O60504.pdb.gz	VINEX_HUMAN Vinexin OS=Homo sapiens OX=9606 GN=SORBS3 PE=1 SV=2
10	AFDB:Q8INU2	0.151	0.049	3.535E-3	1014	0.153	0.039	Q8INU2.pdb.gz	Q8INU2_DROME Dynamin associated protein 160, isoform B OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
11	AFDB:A0AR23	0.163	0.051	4.858E-3	999	0.179	0.047	A0AR23.pdb.gz	A0AR23_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=mib2 PE=2 SV=1
12	AFDB:F4JP43	0.192	0.032	6.332E-3	2037	0.095	0.012	F4JP43.pdb.gz	F4JP43_ARATH G2484-1 protein OS=Arabidopsis thaliana OX=3702 GN=G2484-1 PE=1 SV=1
13	PDB:3mh5A	0.146	0.175	7.175E-3	191	0.057	0.079	3mh5A.pdb.gz	HtrA proteases have a conserved activation mechanism that can be triggered by distinct molecular cues
14	PDB:1ky9B	0.131	0.109	2.846E-2	396	0.115	0.076	1ky9B.pdb.gz
15	PDB:1te0A	0.151	0.135	4.584E-2	318	0.141	0.116	1te0A.pdb.gz
16	PDB:2p4bB	0.119	0.119	5.975E-2	260	0.099	0.100	2p4bB.pdb.gz
17	PDB:1zq1A	0.206	0.132	6.300E-2	437	0.061	0.037	1zq1A.pdb.gz	Structural Basis for tRNA-Dependent Amidotransferase Function
18	PDB:3gdvA	0.146	0.139	7.005E-2	296	0.122	0.108	3gdvA.pdb.gz	OMP peptides activate the DegS stress-sensor protease by a relief of inhibition mechanism.
19	PDB:4a8cA	0.164	0.128	7.788E-2	395	0.111	0.073	4a8cA.pdb.gz
20	PDB:7ungU	0.102	0.060	1.190E-1	485	0.107	0.058	7ungU.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q61142	0.0	543	262	0.992	0.992	SPIN1_MOUSE Spindlin-1 OS=Mus musculus OX=10090 GN=Spin1 PE=1 SV=2
2	Q90WG2	0.0	527	262	0.950	0.950	SPINW_CHICK Spindlin-W OS=Gallus gallus OX=9031 GN=SPINW PE=2 SV=1
3	Q9Y657	0.0	545	262	1.000	1.000	SPIN1_HUMAN Spindlin-1 OS=Homo sapiens OX=9606 GN=SPIN1 PE=1 SV=3
4	Q5JUX0	2.66e-165	459	258	0.832	0.845	SPIN3_HUMAN Spindlin-3 OS=Homo sapiens OX=9606 GN=SPIN3 PE=1 SV=1
5	Q9BPZ2	1.70e-150	422	258	0.771	0.783	SPI2B_HUMAN Spindlin-2B OS=Homo sapiens OX=9606 GN=SPIN2B PE=1 SV=1
6	Q99865	9.61e-150	420	258	0.767	0.779	SPI2A_HUMAN Spindlin-2A OS=Homo sapiens OX=9606 GN=SPIN2A PE=1 SV=3
7	Q5JZB8	5.52e-143	402	247	0.733	0.777	Q5JZB8_HUMAN Spindlin-2B (Fragment) OS=Homo sapiens OX=9606 GN=SPIN2B PE=1 SV=1
8	Q56A73	1.20e-128	366	249	0.702	0.739	SPIN4_HUMAN Spindlin-4 OS=Homo sapiens OX=9606 GN=SPIN4 PE=1 SV=1
9	Q5JZB7	1.18e-46	154	157	0.302	0.503	Q5JZB7_HUMAN Spindlin family member 2B OS=Homo sapiens OX=9606 GN=SPIN2B PE=1 SV=1
10	A0A087X074	5.27e-46	153	157	0.298	0.497	A0A087X074_HUMAN Spindlin family member 2A OS=Homo sapiens OX=9606 GN=SPIN2A PE=3 SV=1
11	Q8LAS7	2.5	31.6	226	0.115	0.133	CNBL2_ARATH Calcineurin B-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=CBL2 PE=1 SV=2
12	Q8L7F6	5.0	30.4	225	0.111	0.129	Q8L7F6_PEA Calcineurin B-like protein OS=Pisum sativum OX=3888 GN=CnB PE=1 SV=2
13	Q8LEM7	6.4	30.0	226	0.111	0.128	CNBL3_ARATH Calcineurin B-like protein 3 OS=Arabidopsis thaliana OX=3702 GN=CBL3 PE=1 SV=2
14	P96912	6.9	30.4	315	0.061	0.051	P96912_MYCTU Possible membrane protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0622 PE=4 SV=3
15	Q9HC84	9.0	30.4	5762	0.065	0.003	MUC5B_HUMAN Mucin-5B OS=Homo sapiens OX=9606 GN=MUC5B PE=1 SV=3
16	Q969W0	9.6	27.7	71	0.050	0.183	SPTSA_HUMAN Serine palmitoyltransferase small subunit A OS=Homo sapiens OX=9606 GN=SPTSSA PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02513 Spin-Ssty	1.4e-72	250.6	Spin/Ssty Family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 185453.XP_006872642.1

Rank	PPI partner	STRING score	Description
1	185453.XP_006867616.1	0.844	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 mRNAs, 10 Proteins
2	185453.XP_006863079.1	0.826	E3 ubiquitin-protein ligase Topors isoform X1
3	185453.XP_006861156.1	0.821	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred complete CDS: substituted 1 base at 1 genomic stop codon
4	185453.XP_006864715.1	0.753	CGG triplet repeat-binding protein 1
5	185453.XP_006861408.1	0.693	Histone H3.2-like isoform X1
6	185453.XP_006872182.1	0.579	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 9 Proteins
7	185453.XP_006831950.1	0.558	cyclin-D1-binding protein 1
8	185453.XP_006835166.1	0.539	ATP synthase subunit alpha, mitochondrial isoform X1
9	185453.XP_006832340.1	0.532	Histone H3.3 type 2-like
10	185453.XP_006865076.1	0.532	Histone H3.3-like
11	185453.XP_006868740.1	0.532	Histone H3.3-like
12	185453.XP_006867375.1	0.505	CCAAT/enhancer-binding protein alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0035064	1.000	methylated histone binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0050794	0.970	regulation of cellular process
GO:0016043	0.963	cellular component organization
GO:0071704	0.955	organic substance metabolic process
GO:0044237	0.951	cellular metabolic process
GO:0048518	0.937	positive regulation of biological process
GO:0044238	0.936	primary metabolic process
GO:0046483	0.936	heterocycle metabolic process
GO:0006807	0.926	nitrogen compound metabolic process
GO:0060255	0.926	regulation of macromolecule metabolic process
GO:0043170	0.922	macromolecule metabolic process
GO:0006139	0.917	nucleobase-containing compound metabolic process
GO:0080090	0.916	regulation of primary metabolic process
GO:0051171	0.916	regulation of nitrogen compound metabolic process
GO:0048522	0.905	positive regulation of cellular process
GO:0031323	0.893	regulation of cellular metabolic process
GO:0090304	0.893	nucleic acid metabolic process
GO:0051252	0.877	regulation of RNA metabolic process
GO:0010468	0.876	regulation of gene expression
GO:0010556	0.876	regulation of macromolecule biosynthetic process
GO:0031326	0.876	regulation of cellular biosynthetic process
GO:0006996	0.815	organelle organization
GO:0007276	0.801	gamete generation
GO:0006355	0.799	regulation of DNA-templated transcription
GO:0016070	0.774	RNA metabolic process
GO:0010467	0.772	gene expression
GO:0007143	0.705	female meiotic nuclear division
GO:0034654	0.626	nucleobase-containing compound biosynthetic process
GO:0051173	0.579	positive regulation of nitrogen compound metabolic process
GO:0098781	0.577	ncRNA transcription
GO:0010604	0.576	positive regulation of macromolecule metabolic process
GO:0031325	0.547	positive regulation of cellular metabolic process
GO:0048583	0.493	regulation of response to stimulus
GO:0030111	0.479	regulation of Wnt signaling pathway
GO:0045935	0.335	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.334	positive regulation of macromolecule biosynthetic process
GO:0031328	0.327	positive regulation of cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.998	cytosol
GO:0043228	0.963	non-membrane-bounded organelle
GO:0043232	0.914	intracellular non-membrane-bounded organelle
GO:0032991	0.580	protein-containing complex
GO:0016020	0.504	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]