StarFunc result for job id Q9Y664

User Input

>input (436 residues)
MMGEAAVAAGPCPLREDSFTRFSSQSNVYGLAGGAGGRGELLAATLKGKVLGFRYQDLRQ
KIRPVAKELQFNYIPVDAEIVSIDTFNKSPPKRGLVVGITFIKDSGDKGSPFLNIYCDYE
PGSEYNLDSIAQSCLNLELQFTPFQLCHAEVQVGDQLETVFLLSGNDPAIHLYKENEGLH
QFEEQPVENLFPELTNLTSSVLWLDVHNFPGTSRRLSALGCQSGYVRVAHVDQRSREVLQ
MWSVLQDGPISRVIVFSLSAAKETKDRPLQDEYSVLVASMLEPAVVYRDLLNRGLEDQLL
LPGSDQFDSVLCSLVTDVDLDGRPEVLVATYGQELLCYKYRGPESGLPEAQHGFHLLWQR
SFSSPLLAMAHVDLTGDGLQELAVVSLKGVHILQHSLIQASELVLTRLRHQVEQRRRRLQ
GLEDGAGAGPAENAAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y664	1.000	1.000	2.139E-78	436	1.000	1.000	Q9Y664.pdb.gz	KPTN_HUMAN KICSTOR complex protein kaptin OS=Homo sapiens OX=9606 GN=KPTN PE=1 SV=2
2	AFDB:B2RYG4	0.955	0.969	9.636E-69	430	0.881	0.893	B2RYG4.pdb.gz	B2RYG4_RAT Kaptin (Actin binding protein) (Predicted), isoform CRA_a OS=Rattus norvegicus OX=10116 GN=Kptn PE=2 SV=1
3	AFDB:A0A1D5PJB7	0.913	0.926	7.024E-55	430	0.622	0.630	A0A1D5PJB7.pdb.gz	KPTN_CHICK KICSTOR complex protein kaptin OS=Gallus gallus OX=9031 GN=KPTN PE=3 SV=1
4	AFDB:Q38DZ1	0.647	0.482	2.411E-11	602	0.170	0.123	Q38DZ1.pdb.gz	Q38DZ1_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.1640 PE=4 SV=1
5	AFDB:Q57WA0	0.520	0.321	1.184E-10	751	0.140	0.081	Q57WA0.pdb.gz	Q57WA0_TRYB2 FG-GAP repeat protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.28C22.950 PE=4 SV=1
6	AFDB:F1Q6W8	0.542	0.351	1.303E-10	715	0.128	0.078	F1Q6W8.pdb.gz
7	AFDB:Q98SP7	0.553	0.352	1.506E-10	715	0.142	0.087	Q98SP7.pdb.gz	BBS2_DANRE Bardet-Biedl syndrome 2 protein homolog OS=Danio rerio OX=7955 GN=bbs2 PE=2 SV=1
8	AFDB:Q9BXC9	0.555	0.352	2.215E-10	721	0.135	0.082	Q9BXC9.pdb.gz	BBS2_HUMAN Bardet-Biedl syndrome 2 protein OS=Homo sapiens OX=9606 GN=BBS2 PE=1 SV=2
9	AFDB:Q8IWZ6	0.525	0.339	2.325E-10	715	0.112	0.069	Q8IWZ6.pdb.gz	BBS7_HUMAN Bardet-Biedl syndrome 7 protein OS=Homo sapiens OX=9606 GN=BBS7 PE=1 SV=2
10	AFDB:Q584V4	0.534	0.335	7.047E-10	736	0.138	0.082	Q584V4.pdb.gz	Q584V4_TRYB2 FG-GAP repeat protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.4M18.130 PE=4 SV=1
11	PDB:7nacm	0.525	0.364	9.526E-9	666	0.106	0.069	7nacm.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
12	PDB:7mq8LT	0.400	0.225	2.381E-8	869	0.138	0.069	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:7mgmC	0.511	0.619	2.499E-8	348	0.101	0.126	7mgmC.pdb.gz	Structural basis for cytoplasmic dynein-1 regulation by Lis1.
14	PDB:3ukrC	0.522	0.635	3.030E-8	349	0.112	0.140	3ukrC.pdb.gz	Structural characterization and computer-aided optimization of a small-molecule inhibitor of the Arp2/3 complex, a key regulator of the actin cytoskeleton.
15	PDB:6elzm	0.534	0.379	3.030E-8	645	0.115	0.078	6elzm.pdb.gz	Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.
16	PDB:5y31B	0.523	0.456	3.675E-8	511	0.083	0.070	5y31B.pdb.gz	Structural basis of epilepsy-related ligand-receptor complex LGI1-ADAM22.
17	PDB:7jvrB	0.462	0.562	4.677E-8	342	0.115	0.146	7jvrB.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
18	PDB:7ajtUO	0.490	0.441	1.287E-7	493	0.112	0.099	7ajtUO.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
19	PDB:5mzhB	0.463	0.483	1.488E-7	415	0.126	0.133	5mzhB.pdb.gz
20	PDB:7mq8LU	0.478	0.470	1.488E-7	445	0.117	0.115	7mq8LU.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1D5PJB7	0.0	528	430	0.626	0.635	KPTN_CHICK KICSTOR complex protein kaptin OS=Gallus gallus OX=9031 GN=KPTN PE=3 SV=1
2	B2RYG4	0.0	776	430	0.881	0.893	B2RYG4_RAT Kaptin (Actin binding protein) (Predicted), isoform CRA_a OS=Rattus norvegicus OX=10116 GN=Kptn PE=2 SV=1
3	Q9Y664	0.0	891	436	1.000	1.000	KPTN_HUMAN KICSTOR complex protein kaptin OS=Homo sapiens OX=9606 GN=KPTN PE=1 SV=2
4	F4IYM4	2.6	33.1	896	0.048	0.023	DEX1_ARATH Protein DEFECTIVE IN EXINE FORMATION 1 OS=Arabidopsis thaliana OX=3702 GN=DEX1 PE=2 SV=1
5	Q8VC69	3.2	32.7	545	0.048	0.039	S22A6_MOUSE Solute carrier family 22 member 6 OS=Mus musculus OX=10090 GN=Slc22a6 PE=1 SV=1
6	Q91WI7	3.3	32.3	443	0.046	0.045	ITFG2_MOUSE KICSTOR complex protein ITFG2 OS=Mus musculus OX=10090 GN=Itfg2 PE=2 SV=1
7	P24814	6.7	31.6	1151	0.085	0.032	GRR1_YEAST SCF E3 ubiquitin ligase complex F-box protein GRR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GRR1 PE=1 SV=1
8	Q8R555	7.4	31.6	646	0.053	0.036	CRAC1_MOUSE Cartilage acidic protein 1 OS=Mus musculus OX=10090 GN=Crtac1 PE=2 SV=1
9	Q9NQ79	8.3	31.2	661	0.053	0.035	CRAC1_HUMAN Cartilage acidic protein 1 OS=Homo sapiens OX=9606 GN=CRTAC1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13336 AcetylCoA_hyd_C	3e+02	12.8	Acetyl-CoA hydrolase/transferase C-terminal domain
2	PF14783 BBS2_Mid	1e+02	14.4	Ciliary BBSome complex subunit 2, middle region
3	PF01839 FG-GAP	0.27	22.4	FG-GAP repeat
4	PF13517 FG-GAP_3	0.18	23.7	FG-GAP-like repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000337850

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000228799	0.999	KICSTOR complex protein ITFG2
2	9606.ENSP00000311486	0.997	KICSTOR complex protein C12orf66
3	9606.ENSP00000457168	0.996	KICSTOR complex protein SZT2
4	9606.ENSP00000383105	0.961	GATOR complex protein DEPDC5
5	9606.ENSP00000362092	0.949	Ras-related GTP-binding protein C
6	9606.ENSP00000343118	0.944	Ragulator complex protein LAMTOR4
7	9606.ENSP00000262850	0.943	Ras-related GTP-binding protein B
8	9606.ENSP00000369899	0.939	Ras-related GTP-binding protein A
9	9606.ENSP00000278671	0.938	Ragulator complex protein LAMTOR1
10	9606.ENSP00000358423	0.938	Ras-related GTP-binding protein D
11	9606.ENSP00000256644	0.933	Ragulator complex protein LAMTOR5
12	9606.ENSP00000354558	0.931	Serine/threonine-protein kinase mTOR
13	9606.ENSP00000424183	0.929	Ragulator complex protein LAMTOR3
14	9606.ENSP00000307272	0.928	Regulatory-associated protein of mTOR
15	9606.ENSP00000262187	0.926	GTP-binding protein Rheb
16	9606.ENSP00000456405	0.916	Target of rapamycin complex subunit LST8
17	9606.ENSP00000357288	0.912	Ragulator complex protein LAMTOR2
18	9606.ENSP00000262144	0.902	GATOR complex protein WDR59
19	9606.ENSP00000285393	0.902	V-type proton ATPase subunit d 2
20	9606.ENSP00000293883	0.902	GATOR complex protein WDR24

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051015	1.000	actin filament binding
GO:0003824	0.352	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0051716	0.996	cellular response to stimulus
GO:0009966	0.995	regulation of signal transduction
GO:0009267	0.988	cellular response to starvation
GO:0008104	0.987	protein localization
GO:0032006	0.986	regulation of TOR signaling
GO:0048523	0.985	negative regulation of cellular process
GO:0034198	0.982	cellular response to amino acid starvation
GO:1903432	0.979	regulation of TORC1 signaling
GO:0032007	0.976	negative regulation of TOR signaling
GO:1904262	0.967	negative regulation of TORC1 signaling
GO:0042149	0.962	cellular response to glucose starvation
GO:0072665	0.954	protein localization to vacuole
GO:0061462	0.915	protein localization to lysosome
GO:0048518	0.359	positive regulation of biological process
GO:0048522	0.340	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.998	membrane-bounded organelle
GO:0005856	0.997	cytoskeleton
GO:0016020	0.993	membrane
GO:0005737	0.993	cytoplasm
GO:0043231	0.993	intracellular membrane-bounded organelle
GO:0030054	0.989	cell junction
GO:0032991	0.986	protein-containing complex
GO:0005829	0.970	cytosol
GO:0015629	0.970	actin cytoskeleton
GO:0045202	0.950	synapse
GO:0031090	0.950	organelle membrane
GO:0098794	0.939	postsynapse
GO:0005765	0.920	lysosomal membrane
GO:0099571	0.919	postsynaptic cytoskeleton
GO:0098871	0.901	postsynaptic actin cytoskeleton
GO:0042995	0.597	cell projection
GO:0099080	0.592	supramolecular complex
GO:0120025	0.579	plasma membrane bounded cell projection
GO:0071944	0.549	cell periphery
GO:0031252	0.446	cell leading edge
GO:0099512	0.423	supramolecular fiber
GO:0005634	0.421	nucleus
GO:0005886	0.366	plasma membrane
GO:0031982	0.364	vesicle
GO:0012505	0.359	endomembrane system
GO:0099513	0.327	polymeric cytoskeletal fiber

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]