StarFunc result for job id Q9Y666

User Input

>input (1083 residues)
MPTNFTVVPVEAHADGGGDETAERTEAPGTPEGPEPERPSPGDGNPRENSPFLNNVEVEQ
ESFFEGKNMALFEEEMDSNPMVSSLLNKLANYTNLSQGVVEHEEDEESRRREAKAPRMGT
FIGVYLPCLQNILGVILFLRLTWIVGVAGVLESFLIVAMCCTCTMLTAISMSAIATNGVV
PAGGSYYMISRSLGPEFGGAVGLCFYLGTTFAGAMYILGTIEIFLTYISPGAAIFQAEAA
GGEAAAMLHNMRVYGTCTLVLMALVVFVGVKYVNKLALVFLACVVLSILAIYAGVIKSAF
DPPDIPVCLLGNRTLSRRSFDACVKAYGIHNNSATSALWGLFCNGSQPSAACDEYFIQNN
VTEIQGIPGAASGVFLENLWSTYAHAGAFVEKKGVPSVPVAEESRASALPYVLTDIAASF
TLLVGIYFPSVTGIMAGSNRSGDLKDAQKSIPTGTILAIVTTSFIYLSCIVLFGACIEGV
VLRDKFGEALQGNLVIGMLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIARDGIVP
FLQVFGHGKANGEPTWALLLTVLICETGILIASLDSVAPILSMFFLMCYLFVNLACAVQT
LLRTPNWRPRFKFYHWTLSFLGMSLCLALMFICSWYYALSAMLIAGCIYKYIEYRGAEKE
WGDGIRGLSLNAARYALLRVEHGPPHTKNWRPQVLVMLNLDAEQAVKHPRLLSFTSQLKA
GKGLTIVGSVLEGTYLDKHMEAQRAEENIRSLMSTEKTKGFCQLVVSSSLRDGMSHLIQS
AGLGGLKHNTVLMAWPASWKQEDNPFSWKNFVDTVRDTTAAHQALLVAKNVDSFPQNQER
FGGGHIDVWWIVHDGGMLMLLPFLLRQHKVWRKCRMRIFTVAQVDDNSIQMKKDLQMFLY
HLRISAEVEVVEMVENDISAFTYERTLMMEQRSQMLKQMQLSKNEQEREAQLIHDRNTAS
HTAAAARTQAPPTPDKVQMTWTREKLIAEKYRSRDTSLSGFKDLFSMKPDQSNVRRMHTA
VKLNGVVLNKSQDAQLVLLNMPGPPKNRQGDENYMEFLEVLTEGLNRVLLVRGGGREVIT
IYS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6m1yA	0.830	0.955	0.000	938	0.654	0.755	6m1yA.pdb.gz	Cryo-EM structures of the full-length human KCC2 and KCC3 cation-chloride cotransporters.
2	PDB:6m23A	0.821	0.945	0.000	936	0.679	0.785	6m23A.pdb.gz	Cryo-EM structures of the full-length human KCC2 and KCC3 cation-chloride cotransporters.
3	PDB:7d99A	0.788	0.952	0.000	891	0.821	0.998	7d99A.pdb.gz	Structures and an activation mechanism of human potassium-chloride cotransporters.
4	AFDB:A0A0B4LGD3	0.841	0.846	0.000	1077	0.536	0.539	A0A0B4LGD3.pdb.gz	A0A0B4LGD3_DROME Kazachoc, isoform G OS=Drosophila melanogaster OX=7227 GN=kcc PE=1 SV=1
5	AFDB:A0A2R8RX62	0.900	0.851	0.000	1146	0.686	0.648	A0A2R8RX62.pdb.gz
6	AFDB:E9QC71	0.883	0.857	0.000	1117	0.687	0.666	E9QC71.pdb.gz
7	AFDB:Q28677	0.912	0.911	0.000	1085	0.705	0.703	Q28677.pdb.gz	S12A4_RABIT Solute carrier family 12 member 4 OS=Oryctolagus cuniculus OX=9986 GN=SLC12A4 PE=1 SV=1
8	AFDB:Q5RK27	0.965	0.965	0.000	1083	0.912	0.912	Q5RK27.pdb.gz	S12A7_RAT Solute carrier family 12 member 7 OS=Rattus norvegicus OX=10116 GN=Slc12a7 PE=2 SV=2
9	AFDB:Q63633	0.932	0.887	0.000	1139	0.737	0.701	Q63633.pdb.gz	S12A5_RAT Solute carrier family 12 member 5 OS=Rattus norvegicus OX=10116 GN=Slc12a5 PE=1 SV=2
10	AFDB:Q924N4	0.907	0.855	0.000	1150	0.693	0.652	Q924N4.pdb.gz	S12A6_MOUSE Solute carrier family 12 member 6 OS=Mus musculus OX=10090 GN=Slc12a6 PE=1 SV=2
11	AFDB:Q9W1G6	0.847	0.878	0.000	1043	0.529	0.549	Q9W1G6.pdb.gz	Q9W1G6_DROME Kazachoc, isoform A OS=Drosophila melanogaster OX=7227 GN=kcc PE=1 SV=2
12	PDB:6y5rA	0.763	0.933	6.071E-102	879	0.617	0.760	6y5rA.pdb.gz
13	PDB:7airA	0.749	0.909	7.601E-100	885	0.615	0.753	7airA.pdb.gz	Phospho-regulation, nucleotide binding and ion access control in potassium-chloride cotransporters.
14	AFDB:H2KZC3	0.568	0.549	4.422E-83	1129	0.447	0.429	H2KZC3.pdb.gz	H2KZC3_CAEEL K+/Cl-Cotransporter OS=Caenorhabditis elegans OX=6239 GN=kcc-2 PE=1 SV=2
15	AFDB:S6FWN4	0.785	0.738	3.164E-82	1156	0.406	0.381	S6FWN4.pdb.gz	S6FWN4_CAEEL K+/Cl-Cotransporter OS=Caenorhabditis elegans OX=6239 GN=kcc-1 PE=1 SV=1
16	PDB:7d14A	0.711	0.895	4.112E-80	850	0.589	0.751	7d14A.pdb.gz
17	PDB:7s1xB	0.458	0.550	5.134E-45	871	0.247	0.307	7s1xB.pdb.gz	Structural basis for inhibition of the Cation-chloride cotransporter NKCC1 by the diuretic drug bumetanide
18	PDB:7d10A	0.356	0.843	4.250E-24	446	0.157	0.381	7d10A.pdb.gz
19	PDB:7cmhB	0.319	0.695	2.294E-8	458	0.074	0.175	7cmhB.pdb.gz	Structural insight into the substrate recognition and transport mechanism of the human LAT2-4F2hc complex.
20	PDB:7dskB	0.299	0.631	6.136E-8	464	0.069	0.162	7dskB.pdb.gz	Mechanism of substrate transport and inhibition of the human LAT1-4F2hc amino acid transporter.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4LGD3	1140	1077	0.533	0.536	A0A0B4LGD3_DROME Kazachoc, isoform G OS=Drosophila melanogaster OX=7227 GN=kcc PE=1 SV=1
2	A0A0B4LHE0	1145	1066	0.527	0.536	A0A0B4LHE0_DROME Kazachoc, isoform F OS=Drosophila melanogaster OX=7227 GN=kcc PE=1 SV=1
3	B4DF30	1536	1079	0.695	0.698	B4DF30_HUMAN cDNA FLJ60065, highly similar to Solute carrier family 12 member 4 OS=Homo sapiens OX=9606 PE=2 SV=1
4	C0KDV0	905	1061	0.444	0.453	C0KDV0_CAEEL K+/Cl-Cotransporter OS=Caenorhabditis elegans OX=6239 GN=kcc-2 PE=1 SV=1
5	G5EEC9	906	1079	0.445	0.447	G5EEC9_CAEEL K+/Cl-Cotransporter OS=Caenorhabditis elegans OX=6239 GN=kcc-2 PE=1 SV=1
6	H2KZC2	905	1102	0.444	0.436	H2KZC2_CAEEL K+/Cl-Cotransporter OS=Caenorhabditis elegans OX=6239 GN=kcc-2 PE=1 SV=1
7	H2KZC3	906	1129	0.444	0.426	H2KZC3_CAEEL K+/Cl-Cotransporter OS=Caenorhabditis elegans OX=6239 GN=kcc-2 PE=1 SV=2
8	Q09573	734	1070	0.380	0.385	KCC3_CAEEL Potassium/chloride cotransporter 3 OS=Caenorhabditis elegans OX=6239 GN=kcc-3 PE=1 SV=2
9	Q28677	1564	1085	0.705	0.704	S12A4_RABIT Solute carrier family 12 member 4 OS=Oryctolagus cuniculus OX=9986 GN=SLC12A4 PE=1 SV=1
10	Q5RK27	2029	1083	0.912	0.912	S12A7_RAT Solute carrier family 12 member 7 OS=Rattus norvegicus OX=10116 GN=Slc12a7 PE=2 SV=2
11	Q63633	1634	1139	0.738	0.701	S12A5_RAT Solute carrier family 12 member 5 OS=Rattus norvegicus OX=10116 GN=Slc12a5 PE=1 SV=2
12	Q8MKK5	1142	1028	0.529	0.557	Q8MKK5_DROME GH09271p OS=Drosophila melanogaster OX=7227 GN=kcc PE=1 SV=1
13	Q8MLQ5	1145	1074	0.536	0.541	Q8MLQ5_DROME Kazachoc, isoform D OS=Drosophila melanogaster OX=7227 GN=kcc PE=1 SV=1
14	Q91V14	1632	1138	0.738	0.702	S12A5_MOUSE Solute carrier family 12 member 5 OS=Mus musculus OX=10090 GN=Slc12a5 PE=1 SV=2
15	Q924N4	1560	1150	0.693	0.653	S12A6_MOUSE Solute carrier family 12 member 6 OS=Mus musculus OX=10090 GN=Slc12a6 PE=1 SV=2
16	Q9H2X9	1628	1139	0.737	0.701	S12A5_HUMAN Solute carrier family 12 member 5 OS=Homo sapiens OX=9606 GN=SLC12A5 PE=1 SV=3
17	Q9JIS8	1564	1085	0.703	0.701	S12A4_MOUSE Solute carrier family 12 member 4 OS=Mus musculus OX=10090 GN=Slc12a4 PE=1 SV=2
18	Q9UHW9	1567	1150	0.692	0.651	S12A6_HUMAN Solute carrier family 12 member 6 OS=Homo sapiens OX=9606 GN=SLC12A6 PE=1 SV=2
19	Q9UP95	1556	1085	0.702	0.700	S12A4_HUMAN Solute carrier family 12 member 4 OS=Homo sapiens OX=9606 GN=SLC12A4 PE=1 SV=2
20	Q9W1G5	1147	1059	0.531	0.543	Q9W1G5_DROME Kazachoc, isoform C OS=Drosophila melanogaster OX=7227 GN=kcc PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00324 AA_permease	7.9e-56	201.3	Amino acid permease
2	PF13520 AA_permease_2	2.5e-10	51.5	Amino acid permease
3	PF03522 SLC12	1.5e-43	161.1	Solute carrier family 12

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264930

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000346667	0.805	Serine/threonine-protein kinase WNK3
2	9606.ENSP00000395983	0.799	Solute carrier family 12 member 4
3	9606.ENSP00000348278	0.791	STE20/SPS1-related proline-alanine-rich protein kinase
4	9606.ENSP00000329932	0.688	Galectin-9C
5	9606.ENSP00000341292	0.648	Serine/threonine-protein kinase WNK1
6	9606.ENSP00000246914	0.638	Serine/threonine-protein kinase WNK4
7	9606.ENSP00000297954	0.601	Serine/threonine-protein kinase WNK2
8	9606.ENSP00000263346	0.588	Transcription factor 25
9	9606.ENSP00000393275	0.572	Nanos homolog 1
10	9606.ENSP00000387694	0.561	Solute carrier family 12 member 5
11	9606.ENSP00000311713	0.515	Serine/threonine-protein kinase OSR1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015379	1.000	potassium:chloride symporter activity
GO:0005515	0.989	protein binding
GO:0015267	0.476	channel activity
GO:0008519	0.368	ammonium transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051234	0.985	establishment of localization
GO:0006810	0.983	transport
GO:0009987	0.979	cellular process
GO:0006811	0.968	monoatomic ion transport
GO:0065007	0.850	biological regulation
GO:0042592	0.712	homeostatic process
GO:0050896	0.411	response to stimulus
GO:0055085	0.365	transmembrane transport
GO:0048878	0.315	chemical homeostasis
GO:0071840	0.311	cellular component organization or biogenesis
GO:0050789	0.301	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0032991	0.773	protein-containing complex
GO:0005622	0.728	intracellular anatomical structure
GO:0005737	0.707	cytoplasm
GO:0043227	0.551	membrane-bounded organelle
GO:0043231	0.302	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29823	1.000	chloride(in) = chloride(out)
RHEA:29463	1.000	K(+)(in) = K(+)(out)
RHEA:28747	0.368	NH4(+)(in) = NH4(+)(out)

[back to server]