StarFunc result for job id Q9Y672

User Input

>input (507 residues)
MEKWYLMTVVVLIGLTVRWTVSLNSYSGAGKPPMFGDYEAQRHWQEITFNLPVKQWYFNS
SDNNLQYWGLDYPPLTAYHSLLCAYVAKFINPDWIALHTSRGYESQAHKLFMRTTVLIAD
LLIYIPAVVLYCCCLKEISTKKKIANALCILLYPGLILIDYGHFQYNSVSLGFALWGVLG
ISCDCDLLGSLAFCLAINYKQMELYHALPFFCFLLGKCFKKGLKGKGFVLLVKLACIVVA
SFVLCWLPFFTEREQTLQVLRRLFPVDRGLFEDKVANIWCSFNVFLKIKDILPRHIQLIM
SFCSTFLSLLPACIKLILQPSSKGFKFTLVSCALSFFLFSFQVHEKSILLVSLPVCLVLS
EIPFMSTWFLLVSTFSMLPLLLKDELLMPSVVTTMAFFIACVTSFSIFEKTSEEELQLKS
FSISVRKYLPCFTFLSRIIQYLFLISVITMVLLTLMTVTLDPPQKLPDLFSVLVCFVSCL
NFLFFLVYFNIIIMWDSKSGRNQKKIS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y672	1.000	1.000	4.756E-63	507	1.000	1.000	Q9Y672.pdb.gz	ALG6_HUMAN Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Homo sapiens OX=9606 GN=ALG6 PE=1 SV=2
2	AFDB:Q9VKX7	0.889	0.949	3.666E-34	475	0.416	0.444	Q9VKX7.pdb.gz	ALG6_DROME Probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=gny PE=2 SV=2
3	AFDB:Q12001	0.867	0.809	5.644E-29	544	0.357	0.333	Q12001.pdb.gz	ALG6_YEAST Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALG6 PE=1 SV=1
4	AFDB:O43053	0.854	0.856	2.909E-27	506	0.333	0.334	O43053.pdb.gz	ALG6_SCHPO Probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg6 PE=3 SV=1
5	PDB:6snhX	0.871	0.920	1.470E-24	479	0.351	0.372	6snhX.pdb.gz	Structure and mechanism of the ER-based glucosyltransferase ALG6.
6	AFDB:Q9W3V8	0.764	0.759	5.455E-18	511	0.284	0.282	Q9W3V8.pdb.gz	ALG8_DROME Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=xit PE=2 SV=1
7	AFDB:Q6P8H8	0.807	0.779	8.714E-18	526	0.247	0.238	Q6P8H8.pdb.gz	ALG8_MOUSE Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Mus musculus OX=10090 GN=Alg8 PE=2 SV=2
8	AFDB:Q9BVK2	0.826	0.797	1.392E-17	526	0.252	0.243	Q9BVK2.pdb.gz	ALG8_HUMAN Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Homo sapiens OX=9606 GN=ALG8 PE=1 SV=2
9	AFDB:P40351	0.721	0.640	6.637E-16	577	0.256	0.225	P40351.pdb.gz	ALG8_YEAST Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALG8 PE=1 SV=1
10	AFDB:Q10479	0.798	0.807	2.502E-15	501	0.245	0.248	Q10479.pdb.gz	ALG8_SCHPO Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg8 PE=3 SV=1
11	AFDB:Q5AMR5	0.514	0.632	1.573E-5	398	0.120	0.153	Q5AMR5.pdb.gz	GPI14_CANAL GPI mannosyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GPI14 PE=3 SV=1
12	PDB:7w72U	0.441	0.517	2.771E-3	420	0.116	0.140	7w72U.pdb.gz	Structure of human glycosylphosphatidylinositol transamidase.
13	PDB:6s7tA	0.329	0.252	5.818E-3	706	0.124	0.089	6s7tA.pdb.gz	Cryo-electron microscopy structures of human oligosaccharyltransferase complexes OST-A and OST-B.
14	PDB:6s7oA	0.395	0.319	1.005E-2	656	0.099	0.076	6s7oA.pdb.gz	Cryo-electron microscopy structures of human oligosaccharyltransferase complexes OST-A and OST-B.
15	PDB:5oglA	0.357	0.273	1.221E-2	707	0.105	0.075	5oglA.pdb.gz	Molecular basis of lipid-linked oligosaccharide recognition and processing by bacterial oligosaccharyltransferase.
16	PDB:6eznF	0.391	0.317	4.260E-2	650	0.120	0.094	6eznF.pdb.gz	Molecular basis for glycan recognition and reaction priming of eukaryotic oligosaccharyltransferase.
17	PDB:7bvfB	0.387	0.214	4.260E-2	1054	0.150	0.072	7bvfB.pdb.gz	Structures of cell wall arabinosyltransferases with the anti-tuberculosis drug ethambutol.
18	PDB:3rceA	0.370	0.287	4.605E-2	683	0.101	0.075	3rceA.pdb.gz	X-ray structure of a bacterial oligosaccharyltransferase.
19	PDB:7sptA	0.130	0.137	5.178E-2	470	0.156	0.168	7sptA.pdb.gz	Molecular basis for inhibiting human glucose transporters by exofacial inhibitors.
20	PDB:6thaA	0.161	0.178	5.384E-2	448	0.132	0.150	6thaA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y672	0.0	1024	507	1.000	1.000	ALG6_HUMAN Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Homo sapiens OX=9606 GN=ALG6 PE=1 SV=2
2	Q9VKX7	3.25e-135	401	475	0.424	0.453	ALG6_DROME Probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=gny PE=2 SV=2
3	O43053	1.11e-93	295	506	0.353	0.354	ALG6_SCHPO Probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg6 PE=3 SV=1
4	Q12001	6.78e-89	284	544	0.369	0.344	ALG6_YEAST Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALG6 PE=1 SV=1
5	Q9BVK2	3.41e-36	143	526	0.249	0.240	ALG8_HUMAN Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Homo sapiens OX=9606 GN=ALG8 PE=1 SV=2
6	Q9W3V8	1.01e-34	138	511	0.241	0.239	ALG8_DROME Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=xit PE=2 SV=1
7	Q6P8H8	1.17e-33	135	526	0.250	0.241	ALG8_MOUSE Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Mus musculus OX=10090 GN=Alg8 PE=2 SV=2
8	P40351	1.87e-33	135	577	0.239	0.210	ALG8_YEAST Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALG8 PE=1 SV=1
9	Q10479	4.26e-31	128	501	0.205	0.208	ALG8_SCHPO Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg8 PE=3 SV=1
10	Q8MXS7	0.99	34.3	401	0.026	0.032	Q8MXS7_CAEEL G-protein coupled receptors family 1 profile domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ser-6 PE=3 SV=1
11	Q6WNX8	1.1	34.3	658	0.061	0.047	Q6WNX8_DROME G-protein coupled receptor OS=Drosophila melanogaster OX=7227 GN=PK2-R1 PE=2 SV=1
12	Q8ITD1	1.1	34.3	658	0.061	0.047	Q8ITD1_DROME Putative PRXamide receptor OS=Drosophila melanogaster OX=7227 GN=PK2-R1 PE=2 SV=1
13	Q9VFW5	1.1	34.3	660	0.061	0.047	Q9VFW5_DROME Pyrokinin 2 receptor 1 OS=Drosophila melanogaster OX=7227 GN=PK2-R1 PE=3 SV=1
14	P34994	1.2	33.9	369	0.028	0.038	SSR2_PIG Somatostatin receptor type 2 OS=Sus scrofa OX=9823 GN=SSTR2 PE=3 SV=1
15	P30680	1.4	33.9	369	0.028	0.038	SSR2_RAT Somatostatin receptor type 2 OS=Rattus norvegicus OX=10116 GN=Sstr2 PE=1 SV=1
16	P30875	1.4	33.9	369	0.028	0.038	SSR2_MOUSE Somatostatin receptor type 2 OS=Mus musculus OX=10090 GN=Sstr2 PE=2 SV=1
17	O43052	2.0	33.9	1150	0.028	0.012	RGA1_SCHPO Rho-type GTPase-activating protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rga1 PE=1 SV=1
18	P30939	2.6	33.1	366	0.065	0.090	5HT1F_HUMAN 5-hydroxytryptamine receptor 1F OS=Homo sapiens OX=9606 GN=HTR1F PE=1 SV=1
19	A8CWP8	3.2	32.7	419	0.034	0.041	A8CWP8_CHICK Arginine vasopressin receptor 1A OS=Gallus gallus OX=9031 GN=VT4 PE=2 SV=1
20	P30874	3.2	32.7	369	0.026	0.035	SSR2_HUMAN Somatostatin receptor type 2 OS=Homo sapiens OX=9606 GN=SSTR2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	74	14.1	7 transmembrane receptor (rhodopsin family)
2	PF03155 Alg6_Alg8	5.6e-144	492.4	ALG6, ALG8 glycosyltransferase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360149

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000239891	0.994	ALG5, dolichyl-phosphate beta-glucosyltransferase
2	9606.ENSP00000482396	0.989	Alpha-1,2-mannosyltransferase ALG9
3	9606.ENSP00000380793	0.985	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase
4	9606.ENSP00000299626	0.959	Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase
5	9606.ENSP00000333813	0.948	Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase
6	9606.ENSP00000266483	0.927	Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase
7	9606.ENSP00000310120	0.917	Putative Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase
8	9606.ENSP00000262374	0.910	Chitobiosyldiphosphodolichol beta-mannosyltransferase
9	9606.ENSP00000482437	0.900	Mannosyltransferase
10	9606.ENSP00000430236	0.874	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase
11	9606.ENSP00000360644	0.869	Dolichol-phosphate mannosyltransferase subunit 1
12	9606.ENSP00000386597	0.853	UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase
13	9606.ENSP00000250124	0.834	Mannose-P-dolichol utilization defect 1 protein
14	9606.ENSP00000378260	0.830	Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13
15	9606.ENSP00000264228	0.828	Polyprenol reductase
16	9606.ENSP00000268261	0.823	Phosphomannomutase 2
17	9606.ENSP00000259253	0.818	UDP-glucose:glycoprotein glucosyltransferase 1
18	9606.ENSP00000233616	0.814	Mannosyl-oligosaccharide glucosidase
19	9606.ENSP00000376472	0.780	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A
20	9606.ENSP00000399457	0.777	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046527	1.000	glucosyltransferase activity
GO:0005488	0.898	binding
GO:0005515	0.892	protein binding
GO:0004583	0.819	dolichyl-phosphate-glucose-glycolipid alpha-glucosyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.998	cellular metabolic process
GO:1901576	0.995	organic substance biosynthetic process
GO:0019538	0.995	protein metabolic process
GO:0006486	0.987	protein glycosylation
GO:0006490	0.969	oligosaccharide-lipid intermediate biosynthetic process
GO:0006487	0.946	protein N-linked glycosylation
GO:0006488	0.310	dolichol-linked oligosaccharide biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	1.000	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.

[back to server]