StarFunc result for job id Q9Y678

User Input

>input (874 residues)
MLKKFDKKDEESGGGSNPFQHLEKSAVLQEARVFNETPINPRKCAHILTKILYLINQGEH
LGTTEATEAFFAMTKLFQSNDPTLRRMCYLTIKEMSCIAEDVIIVTSSLTKDMTGKEDNY
RGPAVRALCQITDSTMLQAIERYMKQAIVDKVPSVSSSALVSSLHLLKCSFDVVKRWVNE
AQEAASSDNIMVQYHALGLLYHVRKNDRLAVNKMISKVTRHGLKSPFAYCMMIRVASKQL
EEEDGSRDSPLFDFIESCLRNKHEMVVYEAASAIVNLPGCSAKELAPAVSVLQLFCSSPK
AALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGSESSIDRL
MKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEYKRAIVDC
IISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTTNPSKYIRFIYNRV
VLEHEEVRAGAVSALAKFGAQNEEMLPSILVLLKRCVMDDDNEVRDRATFYLNVLEQKQK
ALNAGYILNGLTVSIPGLERALQQYTLEPSEKPFDLKSVPLATAPMAEQRTESTPITAVK
QPEKVAATRQEIFQEQLAAVPEFRGLGPLFKSSPEPVALTESETEYVIRCTKHTFTNHMV
FQFDCTNTLNDQTLENVTVQMEPTEAYEVLCYVPARSLPYNQPGTCYTLVALPKEDPTAV
ACTFSCMMKFTVKDCDPTTGETDDEGYEDEYVLEDLEVTVADHIQKVMKLNFEAAWDEVG
DEFEKEETFTLSTIKTLEEAVGNIVKFLGMHPCERSDKVPDNKNTHTLLLAGVFRGGHDI
LVRSRLLLLDTVTMQVTARSLEELPVDIILASVG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P53620	0.990	0.990	0.000	874	0.971	0.971	P53620.pdb.gz	COPG1_BOVIN Coatomer subunit gamma-1 OS=Bos taurus OX=9913 GN=COPG1 PE=1 SV=1
2	AFDB:Q9QXK3	0.971	0.974	2.994E-98	871	0.807	0.809	Q9QXK3.pdb.gz	COPG2_MOUSE Coatomer subunit gamma-2 OS=Mus musculus OX=10090 GN=Copg2 PE=1 SV=1
3	AFDB:Q8I0G5	0.932	0.923	1.801E-80	883	0.602	0.596	Q8I0G5.pdb.gz	COPG_DROME Coatomer subunit gamma OS=Drosophila melanogaster OX=7227 GN=gammaCOP PE=2 SV=1
4	PDB:5a1uE	0.495	0.520	7.545E-76	824	0.921	0.977	5a1uE.pdb.gz
5	AFDB:Q0WW26	0.641	0.633	4.885E-70	886	0.514	0.507	Q0WW26.pdb.gz	COPG_ARATH Coatomer subunit gamma OS=Arabidopsis thaliana OX=3702 GN=At4g34450 PE=1 SV=2
6	PDB:5nzrG	0.508	0.549	7.615E-66	798	0.894	0.979	5nzrG.pdb.gz
7	AFDB:P87140	0.729	0.708	1.469E-62	905	0.415	0.401	P87140.pdb.gz	COPG_SCHPO Probable coatomer subunit gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec21 PE=1 SV=1
8	AFDB:P32074	0.555	0.525	5.063E-56	935	0.349	0.326	P32074.pdb.gz	COPG_YEAST Coatomer subunit gamma OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC21 PE=1 SV=2
9	AFDB:Q382Z1	0.525	0.523	3.984E-52	878	0.288	0.287	Q382Z1.pdb.gz	Q382Z1_TRYB2 Coatomer subunit gamma OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.3740 PE=3 SV=1
10	PDB:5nzrK	0.406	0.577	3.184E-47	560	0.620	0.968	5nzrK.pdb.gz
11	AFDB:Q9SV20	0.383	0.360	6.538E-26	948	0.154	0.142	Q9SV20.pdb.gz	COPB2_ARATH Coatomer subunit beta-2 OS=Arabidopsis thaliana OX=3702 GN=At4g31490 PE=2 SV=2
12	AFDB:Q23924	0.361	0.349	9.206E-26	912	0.141	0.135	Q23924.pdb.gz	COPB_DICDI Coatomer subunit beta OS=Dictyostelium discoideum OX=44689 GN=copb PE=2 SV=2
13	AFDB:Q9UUF7	0.371	0.350	6.645E-25	940	0.129	0.120	Q9UUF7.pdb.gz	COPB_SCHPO Coatomer subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec26 PE=3 SV=1
14	PDB:7p3xA	0.470	0.680	3.807E-10	576	0.086	0.130	7p3xA.pdb.gz
15	PDB:5a1uG	0.238	0.253	1.440E-9	813	0.135	0.145	5a1uG.pdb.gz
16	PDB:7p3xB	0.383	0.500	1.554E-9	621	0.089	0.126	7p3xB.pdb.gz
17	PDB:1b3uA	0.303	0.416	5.447E-9	588	0.100	0.148	1b3uA.pdb.gz
18	PDB:7cunG	0.346	0.340	4.577E-8	895	0.100	0.097	7cunG.pdb.gz	Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase.
19	PDB:6yafB	0.403	0.571	5.329E-8	579	0.103	0.155	6yafB.pdb.gz	Architecture of the AP2/clathrin coat on the membranes of clathrin-coated vesicles.
20	PDB:3nd2A	0.320	0.324	7.794E-8	861	0.087	0.088	3nd2A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P53620	0.0	1777	874	0.971	0.971	COPG1_BOVIN Coatomer subunit gamma-1 OS=Bos taurus OX=9913 GN=COPG1 PE=1 SV=1
2	P87140	0.0	602	905	0.419	0.404	COPG_SCHPO Probable coatomer subunit gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec21 PE=1 SV=1
3	Q0WW26	0.0	890	886	0.514	0.507	COPG_ARATH Coatomer subunit gamma OS=Arabidopsis thaliana OX=3702 GN=At4g34450 PE=1 SV=2
4	Q4AEF8	0.0	1766	874	0.971	0.971	COPG1_RAT Coatomer subunit gamma-1 OS=Rattus norvegicus OX=10116 GN=Copg1 PE=2 SV=1
5	Q8I0G5	0.0	1045	883	0.602	0.596	COPG_DROME Coatomer subunit gamma OS=Drosophila melanogaster OX=7227 GN=gammaCOP PE=2 SV=1
6	Q9QXK3	0.0	1469	871	0.804	0.807	COPG2_MOUSE Coatomer subunit gamma-2 OS=Mus musculus OX=10090 GN=Copg2 PE=1 SV=1
7	Q9QZE5	0.0	1768	874	0.973	0.973	COPG1_MOUSE Coatomer subunit gamma-1 OS=Mus musculus OX=10090 GN=Copg1 PE=1 SV=1
8	Q9UBF2	0.0	1467	871	0.805	0.808	COPG2_HUMAN Coatomer subunit gamma-2 OS=Homo sapiens OX=9606 GN=COPG2 PE=1 SV=1
9	Q9Y678	0.0	1812	874	1.000	1.000	COPG1_HUMAN Coatomer subunit gamma-1 OS=Homo sapiens OX=9606 GN=COPG1 PE=1 SV=1
10	P32074	3.29e-154	478	935	0.360	0.337	COPG_YEAST Coatomer subunit gamma OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC21 PE=1 SV=2
11	Q382Z1	6.59e-126	402	878	0.304	0.303	Q382Z1_TRYB2 Coatomer subunit gamma OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.3740 PE=3 SV=1
12	Q9WV76	1.48e-05	51.2	738	0.120	0.142	AP4B1_MOUSE AP-4 complex subunit beta-1 OS=Mus musculus OX=10090 GN=Ap4b1 PE=1 SV=2
13	Q10567	2.49e-05	50.4	949	0.098	0.091	AP1B1_HUMAN AP-1 complex subunit beta-1 OS=Homo sapiens OX=9606 GN=AP1B1 PE=1 SV=3
14	A5PMS9	3.29e-05	50.1	947	0.102	0.094	A5PMS9_DANRE AP complex subunit beta OS=Danio rerio OX=7955 GN=fa11e04 PE=1 SV=1
15	F4JNZ8	3.68e-05	50.1	916	0.058	0.056	F4JNZ8_ARATH Beta-adaptin-like protein OS=Arabidopsis thaliana OX=3702 GN=At4g11380 PE=1 SV=1
16	O81742	4.64e-05	49.7	893	0.058	0.057	APBLC_ARATH Beta-adaptin-like protein C OS=Arabidopsis thaliana OX=3702 GN=BETAC-AD PE=1 SV=2
17	O35643	8.25e-05	48.9	943	0.096	0.089	AP1B1_MOUSE AP-1 complex subunit beta-1 OS=Mus musculus OX=10090 GN=Ap1b1 PE=1 SV=2
18	Q9UU81	9.01e-05	48.9	865	0.102	0.103	AP1G1_SCHPO AP-1 complex subunit gamma-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=apl4 PE=3 SV=1
19	Q84K16	9.27e-05	48.5	876	0.118	0.118	AP1G1_ARATH AP-1 complex subunit gamma-1 OS=Arabidopsis thaliana OX=3702 GN=GAMMA-ADR PE=1 SV=1
20	Q9DBG3	1.31e-04	48.1	937	0.103	0.096	AP2B1_MOUSE AP-2 complex subunit beta OS=Mus musculus OX=10090 GN=Ap2b1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01602 Adaptin_N	3.3e-132	453.4	Adaptin N terminal region
2	PF00514 Arm	4.8e+02	12.3	Armadillo/beta-catenin-like repeat
3	PF12717 Cnd1	1.9e-07	42.8	non-SMC mitotic condensation complex subunit 1
4	PF12719 Cnd3	1.4e+02	13.1	Nuclear condensing complex subunits, C-term domain
5	PF16381 Coatomer_g_Cpla	1.4e-32	123.6	Coatomer subunit gamma-1 C-terminal appendage platform
6	PF08752 COP-gamma_platf	2.1e-57	205.0	Coatomer gamma subunit appendage platform subdomain
7	PF02985 HEAT	0.21	22.9	HEAT repeat
8	PF13646 HEAT_2	1e-13	62.8	HEAT repeats
9	PF13513 HEAT_EZ	1.6	20.6	HEAT-like repeat
10	PF03130 HEAT_PBS	3.1e+02	13.5	PBS lyase HEAT-like repeat
11	PF14225 MOR2-PAG1_C	1e+02	14.1	Cell morphogenesis C-terminal
12	PF20168 PDS5	4.6	16.5	Sister chromatid cohesion protein PDS5 protein
13	PF11701 UNC45-central	2e+02	13.3	Myosin-binding striated muscle assembly central

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010353054.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010365057.1	0.999	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin- coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins.
2	61622.XP_010365762.1	0.999	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin- coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network.
3	61622.XP_010359050.1	0.998	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin- coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network.
4	61622.XP_010386681.1	0.998	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin- coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins.
5	61622.XP_010384975.1	0.994	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin- coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. The coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins.
6	61622.XP_010372167.1	0.985	The zeta subunit may be involved in regulating the coat assembly and, hence, the rate of biosynthetic protein transport due to its association-dissociation properties with the coatomer complex.
7	61622.XP_010381331.1	0.985	The zeta subunit may be involved in regulating the coat assembly and, hence, the rate of biosynthetic protein transport due to its association-dissociation properties with the coatomer complex.
8	61622.XP_010354458.1	0.958	Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 isoform X1
9	61622.XP_010377103.1	0.958	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin- coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins.
10	61622.XP_010356885.1	0.953	The zeta subunit may be involved in regulating the coat assembly and, hence, the rate of biosynthetic protein transport due to its association-dissociation properties with the coatomer complex.
11	61622.XP_010363522.1	0.906	ADP ribosylation factor GTPase activating protein 1
12	61622.XP_010369391.1	0.891	ADP-ribosylation factor GTPase-activating protein 2 isoform X1
13	61622.XP_010370058.1	0.890	ADP ribosylation factor GTPase activating protein 3
14	61622.XP_010380971.1	0.865	Transmembrane p24 trafficking protein 10
15	61622.XP_010354943.1	0.837	Sec23 homolog A, coat complex II component
16	61622.XP_010368152.1	0.837	Component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). The coat has two main functions, the physical deformation of the endoplasmic reticulum membrane into vesicles and the selection of cargo molecules
17	61622.XP_010362290.1	0.834	SCY1 like pseudokinase 1
18	61622.XP_010378580.1	0.834	N-terminal kinase-like protein
19	61622.XP_010358947.1	0.825	Belongs to the synaptobrevin family.
20	61622.XP_010379922.1	0.815	Splicing factor 3b subunit 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0016192	0.986	vesicle-mediated transport
GO:0048193	0.959	Golgi vesicle transport
GO:0009987	0.916	cellular process
GO:0051641	0.812	cellular localization
GO:0006890	0.594	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum
GO:0051649	0.567	establishment of localization in cell
GO:0046907	0.555	intracellular transport
GO:0006891	0.523	intra-Golgi vesicle-mediated transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	0.999	Golgi membrane
GO:0005829	0.953	cytosol
GO:0032991	0.943	protein-containing complex
GO:0005783	0.855	endoplasmic reticulum
GO:0030659	0.846	cytoplasmic vesicle membrane
GO:0030135	0.722	coated vesicle
GO:0042175	0.688	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0031984	0.679	organelle subcompartment
GO:0005798	0.675	Golgi-associated vesicle
GO:0030137	0.672	COPI-coated vesicle
GO:0005789	0.640	endoplasmic reticulum membrane
GO:0030662	0.605	coated vesicle membrane
GO:0098796	0.499	membrane protein complex
GO:0030133	0.490	transport vesicle
GO:0030663	0.383	COPI-coated vesicle membrane
GO:0030120	0.367	vesicle coat
GO:0030126	0.346	COPI vesicle coat
GO:0005886	0.341	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]