StarFunc result for job id Q9Y679

User Input

>input (410 residues)
MELPSGPGPERLFDSHRLPGDCFLLLVLLLYAPVGFCLLVLRLFLGIHVFLVSCALPDSV
LRRFVVRTMCAVLGLVARQEDSGLRDHSVRVLISNHVTPFDHNIVNLLTTCSTPLLNSPP
SFVCWSRGFMEMNGRGELVESLKRFCASTRLPPTPLLLFPEEEATNGREGLLRFSSWPFS
IQDVVQPLTLQVQRPLVSVTVSDASWVSELLWSLFVPFTVYQVRWLRPVHRQLGEANEEF
ALRVQQLVAKELGQTGTRLTPADKAEHMKRQRHPRLRPQSAQSSFPPSPGPSPDVQLATL
AQRVKEVLPHVPLGVIQRDLAKTGCVDLTITNLLEGAVAFMPEDITKGTQSLPTASASKF
PSSGPVTPQPTALTFAKSSWARQESLQERKQALYEYARRRFTERRAQEAD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y679	1.000	1.000	1.996E-78	410	1.000	1.000	Q9Y679.pdb.gz	AUP1_HUMAN Lipid droplet-regulating VLDL assembly factor AUP1 OS=Homo sapiens OX=9606 GN=AUP1 PE=1 SV=2
2	AFDB:Q9N5S8	0.442	0.308	1.751E-16	617	0.156	0.104	Q9N5S8.pdb.gz	Q9N5S8_CAEEL Phospholipid/glycerol acyltransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=acl-4 PE=1 SV=1
3	AFDB:Q960R0	0.495	0.447	3.588E-15	458	0.146	0.131	Q960R0.pdb.gz	Q960R0_DROME Glycerol-3-phosphate acyltransferase 4, isoform B OS=Drosophila melanogaster OX=7227 GN=Gpat4 PE=1 SV=1
4	AFDB:Q21812	0.452	0.370	4.526E-15	512	0.149	0.119	Q21812.pdb.gz	Q21812_CAEEL Phospholipid/glycerol acyltransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=acl-5 PE=1 SV=1
5	AFDB:Q8C0N2	0.494	0.466	7.203E-15	438	0.151	0.142	Q8C0N2.pdb.gz	GPAT3_MOUSE Glycerol-3-phosphate acyltransferase 3 OS=Mus musculus OX=10090 GN=Gpat3 PE=1 SV=1
6	AFDB:Q9W1B5	0.450	0.407	2.439E-14	459	0.120	0.107	Q9W1B5.pdb.gz	Q9W1B5_DROME Glycerol-3-phosphate acyltransferase 4, isoform C OS=Drosophila melanogaster OX=7227 GN=Gpat4 PE=1 SV=2
7	AFDB:Q554U0	0.486	0.416	2.739E-14	488	0.146	0.123	Q554U0.pdb.gz	Q554U0_DICDI Phospholipid/glycerol acyltransferase domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0274969 PE=3 SV=1
8	AFDB:Q9SHJ5	0.490	0.354	3.076E-14	585	0.137	0.096	Q9SHJ5.pdb.gz	GPAT1_ARATH Glycerol-3-phosphate acyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=GPAT1 PE=1 SV=1
9	AFDB:Q86UL3	0.478	0.435	4.359E-14	456	0.134	0.121	Q86UL3.pdb.gz	GPAT4_HUMAN Glycerol-3-phosphate acyltransferase 4 OS=Homo sapiens OX=9606 GN=GPAT4 PE=1 SV=1
10	AFDB:O80437	0.486	0.404	4.619E-14	501	0.124	0.102	O80437.pdb.gz	GPAT6_ARATH Glycerol-3-phosphate 2-O-acyltransferase 6 OS=Arabidopsis thaliana OX=3702 GN=GPAT6 PE=1 SV=1
11	PDB:5f2tB	0.292	0.421	8.961E-3	262	0.098	0.153	5f2tB.pdb.gz	Structural basis for selective recognition of acyl chains by the membrane-associated acyltransferase PatA.
12	PDB:3geiA	0.087	0.084	5.866E-1	428	0.105	0.100	3geiA.pdb.gz
13	PDB:7z6hK	0.120	0.114	5.866E-1	439	0.076	0.071	7z6hK.pdb.gz	Structure of the human RAD17-RFC clamp loader and 9-1-1 checkpoint clamp bound to a dsDNA-ssDNA junction.
14	PDB:1em8A	0.094	0.192	7.842E-1	147	0.051	0.143	1em8A.pdb.gz
15	PDB:8cs9g	0.089	0.059	1.177	832	0.073	0.036	8cs9g.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
16	PDB:7st9A	0.115	0.098	1.248	522	0.068	0.054	7st9A.pdb.gz	Mechanisms of loading and release of the 9-1-1 checkpoint clamp.
17	PDB:1a9oA	0.101	0.122	1.874	289	0.054	0.076	1a9oA.pdb.gz	Calf spleen purine nucleoside phosphorylase complexed with substrates and substrate analogues.
18	PDB:1ko5A	0.112	0.213	1.874	172	0.017	0.041	1ko5A.pdb.gz	Conformational changes during the catalytic cycle of gluconate kinase as revealed by X-ray crystallography.
19	PDB:6hivCR	0.068	0.083	2.105	314	0.056	0.073	6hivCR.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
20	PDB:3vcoA	0.147	0.271	2.230	183	0.034	0.077	3vcoA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y679	0.0	828	410	1.000	1.000	AUP1_HUMAN Lipid droplet-regulating VLDL assembly factor AUP1 OS=Homo sapiens OX=9606 GN=AUP1 PE=1 SV=2
2	Q9W1B5	6.70e-06	50.4	459	0.146	0.131	Q9W1B5_DROME Glycerol-3-phosphate acyltransferase 4, isoform C OS=Drosophila melanogaster OX=7227 GN=Gpat4 PE=1 SV=2
3	Q960R0	1.38e-05	49.3	458	0.149	0.133	Q960R0_DROME Glycerol-3-phosphate acyltransferase 4, isoform B OS=Drosophila melanogaster OX=7227 GN=Gpat4 PE=1 SV=1
4	G5EE59	5.11e-05	47.8	441	0.134	0.125	G5EE59_CAEEL Phospholipid/glycerol acyltransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_M79.2 PE=1 SV=1
5	A0A0B4LGJ9	9.26e-05	47.0	537	0.115	0.088	A0A0B4LGJ9_DROME Glycerol-3-phosphate acyltransferase 4, isoform D OS=Drosophila melanogaster OX=7227 GN=Gpat4 PE=1 SV=1
6	A0A0B4LHH1	2.40e-04	45.4	380	0.095	0.103	A0A0B4LHH1_DROME Glycerol-3-phosphate acyltransferase 4, isoform E OS=Drosophila melanogaster OX=7227 GN=Gpat4 PE=1 SV=1
7	F1QB30	3.75e-04	45.1	620	0.098	0.065	F1QB30_DANRE Autocrine motility factor receptor a OS=Danio rerio OX=7955 GN=amfr PE=4 SV=1
8	Q9N5S8	5.21e-04	44.7	617	0.112	0.075	Q9N5S8_CAEEL Phospholipid/glycerol acyltransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=acl-4 PE=1 SV=1
9	Q9N5S9	5.43e-04	44.3	410	0.112	0.112	Q9N5S9_CAEEL Phospholipid/glycerol acyltransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=acl-4 PE=1 SV=2
10	Q6PFU8	6.26e-04	44.3	620	0.098	0.065	Q6PFU8_DANRE Autocrine motility factor receptor OS=Danio rerio OX=7955 GN=amfr PE=2 SV=1
11	Q9R049	0.002	42.7	643	0.088	0.056	AMFR_MOUSE E3 ubiquitin-protein ligase AMFR OS=Mus musculus OX=10090 GN=Amfr PE=1 SV=2
12	Q9UKV5	0.002	43.1	643	0.088	0.056	AMFR_HUMAN E3 ubiquitin-protein ligase AMFR OS=Homo sapiens OX=9606 GN=AMFR PE=1 SV=2
13	A0A0G2K437	0.004	42.0	770	0.085	0.045	A0A0G2K437_RAT Autocrine motility factor receptor OS=Rattus norvegicus OX=10116 GN=Amfr PE=1 SV=2
14	R4GNG2	0.004	41.2	299	0.088	0.120	R4GNG2_HUMAN Autocrine motility factor receptor (Fragment) OS=Homo sapiens OX=9606 GN=AMFR PE=1 SV=1
15	F4KD92	0.006	41.2	595	0.044	0.030	F4KD92_ARATH RPM1 interacting protein 3 OS=Arabidopsis thaliana OX=3702 GN=RIN3 PE=1 SV=1
16	Q8W4Q5	0.006	41.2	577	0.044	0.031	RIN3_ARATH E3 ubiquitin protein ligase RIN3 OS=Arabidopsis thaliana OX=3702 GN=RIN3 PE=1 SV=2
17	P90859	0.007	41.2	564	0.073	0.053	HRDL1_CAEEL E3 ubiquitin-protein ligase hrd-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=hrdl-1 PE=1 SV=2
18	Q554U0	0.014	40.0	488	0.151	0.127	Q554U0_DICDI Phospholipid/glycerol acyltransferase domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0274969 PE=3 SV=1
19	Q8VYC8	0.016	40.0	578	0.041	0.029	RIN2_ARATH E3 ubiquitin protein ligase RIN2 OS=Arabidopsis thaliana OX=3702 GN=RIN2 PE=1 SV=1
20	O80437	0.035	38.5	501	0.124	0.102	GPAT6_ARATH Glycerol-3-phosphate 2-O-acyltransferase 6 OS=Arabidopsis thaliana OX=3702 GN=GPAT6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02845 CUE	2.5e-06	38.4	CUE domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000366748

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000338348	0.994	Ubiquitin-conjugating enzyme E2 G2
2	9606.ENSP00000337053	0.991	Protein sel-1 homolog 1
3	9606.ENSP00000366395	0.965	E3 ubiquitin-protein ligase synoviolin
4	9606.ENSP00000261942	0.932	FAS-associated factor 2
5	9606.ENSP00000318165	0.918	Protein OS-9
6	9606.ENSP00000158771	0.916	Derlin-2
7	9606.ENSP00000451261	0.875	Ubiquitin-conjugating enzyme E2 J1
8	9606.ENSP00000351777	0.867	Transitional endoplasmic reticulum ATPase
9	9606.ENSP00000359685	0.797	Protein tyrosine phosphatase type IVA 1
10	9606.ENSP00000247461	0.789	Calnexin
11	9606.ENSP00000290649	0.788	E3 ubiquitin-protein ligase AMFR
12	9606.ENSP00000327801	0.776	Protein disulfide-isomerase
13	9606.ENSP00000233242	0.755	Apolipoprotein B-100
14	9606.ENSP00000324173	0.746	78 kDa glucose-regulated protein
15	9606.ENSP00000274140	0.736	E3 ubiquitin-protein ligase MARCH6
16	9606.ENSP00000304051	0.735	E3 ubiquitin-protein ligase RNF139
17	9606.ENSP00000384744	0.735	Derlin-3
18	9606.ENSP00000479216	0.699	UBX domain-containing protein 8
19	9606.ENSP00000383911	0.697	Ubiquitin-associated domain-containing protein 2
20	9606.ENSP00000264028	0.689	Coatomer subunit delta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031625	1.000	ubiquitin protein ligase binding
GO:0031624	1.000	ubiquitin conjugating enzyme binding
GO:0003824	0.526	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0019941	0.996	modification-dependent protein catabolic process
GO:0036503	0.995	ERAD pathway
GO:0030433	0.992	ubiquitin-dependent ERAD pathway
GO:0006886	0.990	intracellular protein transport
GO:0016043	0.980	cellular component organization
GO:0032527	0.963	protein exit from endoplasmic reticulum
GO:0035966	0.947	response to topologically incorrect protein
GO:0006996	0.934	organelle organization
GO:0071310	0.906	cellular response to organic substance
GO:0035967	0.896	cellular response to topologically incorrect protein
GO:0051788	0.840	response to misfolded protein
GO:0071218	0.780	cellular response to misfolded protein
GO:0034389	0.572	lipid droplet organization
GO:0044085	0.527	cellular component biogenesis
GO:0061919	0.495	process utilizing autophagic mechanism
GO:0016236	0.485	macroautophagy
GO:0022607	0.470	cellular component assembly
GO:0061912	0.426	selective autophagy
GO:0065007	0.407	biological regulation
GO:0033365	0.405	protein localization to organelle
GO:0070925	0.400	organelle assembly
GO:0010876	0.392	lipid localization
GO:0140694	0.363	non-membrane-bounded organelle assembly
GO:0050789	0.355	regulation of biological process
GO:0050794	0.348	regulation of cellular process
GO:0051707	0.348	response to other organism
GO:0009615	0.341	response to virus
GO:0051235	0.337	maintenance of location
GO:0019915	0.329	lipid storage

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0005789	0.998	endoplasmic reticulum membrane
GO:0070062	0.989	extracellular exosome
GO:0005773	0.987	vacuole
GO:0005811	0.984	lipid droplet
GO:0005776	0.955	autophagosome
GO:0070013	0.656	intracellular organelle lumen
GO:0031981	0.421	nuclear lumen
GO:0005654	0.393	nucleoplasm
GO:0071944	0.360	cell periphery
GO:0005829	0.300	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]