StarFunc result for job id Q9Y689

User Input

>input (179 residues)
MGILFTRIWRLFNHQEHKVIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEIVINNT
RFLMWDIGGQESLRSSWNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGL
LIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQACCALTGEGLCQGLEWMMSRLKIR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P51646	0.994	0.994	5.128E-40	179	0.994	0.994	P51646.pdb.gz	ARL5A_RAT ADP-ribosylation factor-like protein 5A OS=Rattus norvegicus OX=10116 GN=Arl5a PE=2 SV=1
2	AFDB:Q96KC2	0.961	0.961	5.402E-34	179	0.799	0.799	Q96KC2.pdb.gz	ARL5B_HUMAN ADP-ribosylation factor-like protein 5B OS=Homo sapiens OX=9606 GN=ARL5B PE=1 SV=1
3	AFDB:Q9VSG8	0.984	0.984	4.267E-32	179	0.721	0.721	Q9VSG8.pdb.gz	Q9VSG8_DROME ADP-ribosylation factor-like 5 OS=Drosophila melanogaster OX=7227 GN=Arl5 PE=2 SV=1
4	PDB:1zj6A	0.740	0.764	1.093E-29	173	0.961	0.994	1zj6A.pdb.gz	2.0A crystal structure of human ARL5-GDP3'P, a novel member of the small GTP-binding proteins
5	AFDB:Q9LIK1	0.927	0.907	1.217E-27	183	0.564	0.552	Q9LIK1.pdb.gz	Q9LIK1_ARATH ADP-ribosylation factor C1 OS=Arabidopsis thaliana OX=3702 GN=ARFC1 PE=1 SV=1
6	PDB:1yzgA	0.724	0.769	1.433E-27	168	0.765	0.815	1yzgA.pdb.gz	Structure of Human ADP-ribosylation factor-like 8
7	AFDB:P34212	0.898	0.903	3.804E-27	178	0.492	0.494	P34212.pdb.gz	ARL5_CAEEL ADP-ribosylation factor-like protein 5 OS=Caenorhabditis elegans OX=6239 GN=arl-5 PE=3 SV=3
8	AFDB:Q5AND9	0.913	0.903	2.708E-26	181	0.503	0.497	Q5AND9.pdb.gz	Q5AND9_CANAL ADP-ribosylation factor OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ARF2 PE=1 SV=1
9	AFDB:P40616	0.930	0.920	3.489E-26	181	0.492	0.486	P40616.pdb.gz	ARL1_HUMAN ADP-ribosylation factor-like protein 1 OS=Homo sapiens OX=9606 GN=ARL1 PE=1 SV=1
10	AFDB:P25160	0.941	0.936	5.102E-26	180	0.458	0.456	P25160.pdb.gz	ARL1_DROME ADP-ribosylation factor-like protein 1 OS=Drosophila melanogaster OX=7227 GN=Arl1 PE=2 SV=5
11	AFDB:P40940	0.922	0.907	5.435E-26	182	0.497	0.489	P40940.pdb.gz	ARF3_ARATH ADP-ribosylation factor 3 OS=Arabidopsis thaliana OX=3702 GN=ARF3 PE=1 SV=2
12	AFDB:Q38D64	0.907	0.893	9.020E-26	182	0.480	0.473	Q38D64.pdb.gz	Q38D64_TRYB2 ADP-ribosylation factor OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.4470 PE=3 SV=1
13	PDB:1uptG	0.909	0.957	1.518E-24	170	0.453	0.476	1uptG.pdb.gz	Structural Basis for Arl1-Dependent Targeting of Homodimeric Grip Domains to the Golgi Apparatus
14	PDB:6bbpA	0.893	0.313	6.365E-23	520	0.408	0.140	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
15	PDB:3lvqE	0.884	0.381	1.945E-21	420	0.408	0.174	3lvqE.pdb.gz	The structure of an Arf-ArfGAP complex reveals a Ca2+ regulatory mechanism
16	PDB:3doeA	0.903	0.856	2.352E-21	189	0.402	0.381	3doeA.pdb.gz	Crystal structure of the ARL2-GTP-BART complex reveals a novel recognition and binding mode of small GTPase with effector
17	PDB:4zi2A	0.885	0.857	5.356E-21	185	0.385	0.373	4zi2A.pdb.gz	The Interaction of CCDC104/BARTL1 with Arl3 and Implications for Ciliary Function.
18	PDB:3lrpA	0.754	0.746	2.157E-20	181	0.469	0.464	3lrpA.pdb.gz	Structure of Plasmodium falciparum ADP-ribosylation factor 1.
19	PDB:8d9rC	0.887	0.882	2.448E-20	180	0.475	0.472	8d9rC.pdb.gz	Self-assembly and structure of a clathrin-independent AP-1:Arf1 tubular membrane coat.
20	PDB:3o47A	0.731	0.466	1.119E-19	289	0.447	0.277	3o47A.pdb.gz	Crystal structure of ARFGAP1-ARF1 fusion protein

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y689	2.05e-133	372	179	1.000	1.000	ARL5A_HUMAN ADP-ribosylation factor-like protein 5A OS=Homo sapiens OX=9606 GN=ARL5A PE=1 SV=1
2	P51646	2.86e-133	372	179	0.994	0.994	ARL5A_RAT ADP-ribosylation factor-like protein 5A OS=Rattus norvegicus OX=10116 GN=Arl5a PE=2 SV=1
3	Q96KC2	3.97e-111	315	179	0.799	0.799	ARL5B_HUMAN ADP-ribosylation factor-like protein 5B OS=Homo sapiens OX=9606 GN=ARL5B PE=1 SV=1
4	Q9VSG8	1.53e-99	286	179	0.721	0.721	Q9VSG8_DROME ADP-ribosylation factor-like 5 OS=Drosophila melanogaster OX=7227 GN=Arl5 PE=2 SV=1
5	Q9LIK1	1.79e-73	221	183	0.564	0.552	Q9LIK1_ARATH ADP-ribosylation factor C1 OS=Arabidopsis thaliana OX=3702 GN=ARFC1 PE=1 SV=1
6	Q5AND9	8.56e-63	193	181	0.503	0.497	Q5AND9_CANAL ADP-ribosylation factor OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ARF2 PE=1 SV=1
7	Q803D1	9.55e-63	193	180	0.486	0.483	Q803D1_DANRE ADP-ribosylation factor OS=Danio rerio OX=7955 GN=wu:fb33e02 PE=1 SV=1
8	B5X3E2	1.90e-62	192	180	0.486	0.483	B5X3E2_SALSA ADP-ribosylation factor OS=Salmo salar OX=8030 GN=ARF1 PE=2 SV=1
9	P61209	4.60e-62	191	182	0.503	0.495	ARF1_DROME ADP-ribosylation factor 1 OS=Drosophila melanogaster OX=7227 GN=Arf1 PE=1 SV=2
10	P11076	7.86e-62	191	181	0.503	0.497	ARF1_YEAST ADP-ribosylation factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARF1 PE=1 SV=3
11	Q10943	8.49e-62	191	181	0.492	0.486	ARF12_CAEEL ADP-ribosylation factor 1-like 2 OS=Caenorhabditis elegans OX=6239 GN=arf-1.2 PE=2 SV=2
12	P34212	1.68e-61	190	178	0.497	0.500	ARL5_CAEEL ADP-ribosylation factor-like protein 5 OS=Caenorhabditis elegans OX=6239 GN=arl-5 PE=3 SV=3
13	B5X3Q1	2.13e-61	190	181	0.492	0.486	B5X3Q1_SALSA ADP-ribosylation factor OS=Salmo salar OX=8030 GN=ARF1 PE=2 SV=1
14	P40940	4.09e-61	189	182	0.497	0.489	ARF3_ARATH ADP-ribosylation factor 3 OS=Arabidopsis thaliana OX=3702 GN=ARF3 PE=1 SV=2
15	B5DG68	6.41e-61	189	181	0.486	0.481	B5DG68_SALSA ADP-ribosylation factor OS=Salmo salar OX=8030 GN=arf1l PE=2 SV=1
16	P84077	8.70e-61	188	181	0.486	0.481	ARF1_HUMAN ADP-ribosylation factor 1 OS=Homo sapiens OX=9606 GN=ARF1 PE=1 SV=2
17	P84078	8.70e-61	188	181	0.486	0.481	ARF1_MOUSE ADP-ribosylation factor 1 OS=Mus musculus OX=10090 GN=Arf1 PE=1 SV=2
18	P84079	8.70e-61	188	181	0.486	0.481	ARF1_RAT ADP-ribosylation factor 1 OS=Rattus norvegicus OX=10116 GN=Arf1 PE=1 SV=2
19	P84080	8.70e-61	188	181	0.486	0.481	ARF1_BOVIN ADP-ribosylation factor 1 OS=Bos taurus OX=9913 GN=ARF1 PE=1 SV=2
20	Q8BSL7	9.18e-61	188	181	0.486	0.481	ARF2_MOUSE ADP-ribosylation factor 2 OS=Mus musculus OX=10090 GN=Arf2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13173 AAA_14	91	14.5	AAA domain
2	PF00025 Arf	4e-62	220.3	ADP-ribosylation factor family
3	PF02421 FeoB_N	1.8e+02	13.0	Ferrous iron transport protein B
4	PF00503 G-alpha	1.7e-05	35.7	G-protein alpha subunit
5	PF00009 GTP_EFTU	39	15.2	Elongation factor Tu GTP binding domain
6	PF04670 Gtr1_RagA	0.049	24.6	Gtr1/RagA G protein conserved region
7	PF01926 MMR_HSR1	0.0019	29.7	50S ribosome-binding GTPase
8	PF00071 Ras	3.4e-10	51.2	Ras family
9	PF08477 Roc	3e-11	55.0	Ras of Complex, Roc, domain of DAPkinase
10	PF09439 SRPRB	1.5e-08	45.8	Signal recognition particle receptor beta subunit
11	PF05621 TniB	2.4e+02	12.5	Bacterial TniB protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010371209.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010363522.1	0.798	ADP ribosylation factor GTPase activating protein 1
2	61622.XP_010354458.1	0.784	Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 isoform X1
3	61622.XP_010364713.1	0.752	Bardet-Biedl syndrome 1 protein
4	61622.XP_010369391.1	0.735	ADP-ribosylation factor GTPase-activating protein 2 isoform X1
5	61622.XP_010370058.1	0.735	ADP ribosylation factor GTPase activating protein 3
6	61622.XP_010353123.1	0.727	Kalirin, RhoGEF kinase
7	61622.XP_010386681.1	0.710	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin- coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins.
8	61622.XP_010373626.1	0.692	cyclin-G-associated kinase isoform X1
9	61622.XP_010360862.1	0.682	The BBSome complex is thought to function as a coat complex required for sorting of specific membrane proteins to the primary cilia. The BBSome complex is required for ciliogenesis but is dispensable for centriolar satellite function.
10	61622.XP_010379425.1	0.669	MON2 homolog, regulator of endosome-to-Golgi trafficking
11	61622.XP_010365057.1	0.650	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin- coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins.
12	61622.XP_010379970.1	0.648	VPS54, GARP complex subunit
13	61622.XP_010363740.1	0.637	Bardet-Biedl syndrome 2
14	61622.XP_010359050.1	0.632	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin- coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network.
15	61622.XP_010369015.1	0.626	DnaJ heat shock protein family (Hsp40) member C6
16	61622.XP_010365762.1	0.617	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin- coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network.
17	61622.XP_010353054.1	0.601	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin- coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins.
18	61622.XP_010377103.1	0.601	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin- coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins.
19	61622.XP_010385487.1	0.600	Belongs to the PI3/PI4-kinase family.
20	61622.XP_010387435.1	0.588	Belongs to the TOM1 family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005525	0.997	GTP binding
GO:0003824	0.816	catalytic activity
GO:0017111	0.745	ribonucleoside triphosphate phosphatase activity
GO:0003924	0.737	GTPase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0051641	0.997	cellular localization
GO:0033365	0.986	protein localization to organelle
GO:0034067	0.976	protein localization to Golgi apparatus
GO:0051668	0.959	localization within membrane
GO:0072657	0.751	protein localization to membrane
GO:0051234	0.530	establishment of localization
GO:0006810	0.446	transport
GO:0071840	0.381	cellular component organization or biogenesis
GO:0016043	0.354	cellular component organization
GO:0050789	0.308	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0012505	0.996	endomembrane system
GO:0005794	0.929	Golgi apparatus
GO:0016020	0.858	membrane
GO:0005829	0.850	cytosol
GO:0031984	0.642	organelle subcompartment
GO:0031982	0.586	vesicle
GO:0005802	0.451	trans-Golgi network
GO:0071944	0.361	cell periphery
GO:0005886	0.334	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:23680	0.745	a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate
EC:3.6.1.15	0.745	nucleoside-triphosphate phosphatase.
RHEA:19669	0.737	GTP + H2O = GDP + H(+) + phosphate

[back to server]