StarFunc result for job id Q9Y691

User Input

>input (235 residues)
MFIWTSGRTSSSYRHDEKRNIYQKIRDHDLLDKRKTVTALKAGEDRAILLGLAMMVCSIM
MYFLLGITLLRSYMQSVWTEESQCTLLNASITETFNCSFSCGPDCWKLSQYPCLQVYVNL
TSSGEKLLLYHTEETIKINQKCSYIPKCGKNFEESMSLVNVVMENFRKYQHFSCYSDPEG
NQKSVILTKLYSSNVLFHSLFWPTCMMAGGVAIVAMVKLTQYLSLLCERIQRINR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q811Q0	0.982	0.982	2.768E-42	235	0.957	0.957	Q811Q0.pdb.gz	KCMB2_RAT Calcium-activated potassium channel subunit beta-2 OS=Rattus norvegicus OX=10116 GN=Kcnmb2 PE=2 SV=1
2	AFDB:Q9NPA1	0.726	0.620	5.815E-23	279	0.374	0.315	Q9NPA1.pdb.gz	KCMB3_HUMAN Calcium-activated potassium channel subunit beta-3 OS=Homo sapiens OX=9606 GN=KCNMB3 PE=1 SV=2
3	AFDB:Q16558	0.737	0.902	8.765E-22	191	0.353	0.435	Q16558.pdb.gz	KCMB1_HUMAN Calcium-activated potassium channel subunit beta-1 OS=Homo sapiens OX=9606 GN=KCNMB1 PE=1 SV=5
4	AFDB:P97678	0.734	0.895	1.701E-21	191	0.353	0.435	P97678.pdb.gz	KCMB1_RAT Calcium-activated potassium channel subunit beta-1 OS=Rattus norvegicus OX=10116 GN=Kcnmb1 PE=2 SV=4
5	AFDB:Q86W47	0.727	0.804	1.229E-19	210	0.268	0.300	Q86W47.pdb.gz	KCMB4_HUMAN Calcium-activated potassium channel subunit beta-4 OS=Homo sapiens OX=9606 GN=KCNMB4 PE=1 SV=2
6	PDB:6v22E	0.652	0.752	4.864E-18	199	0.264	0.312	6v22E.pdb.gz	Molecular structures of the human Slo1 K + channel in complex with beta 4.
7	AFDB:Q9VH54	0.319	0.279	3.089E-5	279	0.170	0.143	Q9VH54.pdb.gz	Q9VH54_DROME GH24564p OS=Drosophila melanogaster OX=7227 GN=Teh1 PE=2 SV=2
8	AFDB:B6IDT8	0.328	0.263	2.002E-4	313	0.183	0.137	B6IDT8.pdb.gz	B6IDT8_DROME IP20336p OS=Drosophila melanogaster OX=7227 GN=Teh2 PE=2 SV=1
9	AFDB:Q4G0X4	0.160	0.147	2.808E-2	260	0.072	0.065	Q4G0X4.pdb.gz	KCD21_HUMAN BTB/POZ domain-containing protein KCTD21 OS=Homo sapiens OX=9606 GN=KCTD21 PE=1 SV=1
10	AFDB:Q8K485	0.172	0.173	9.376E-2	232	0.060	0.060	Q8K485.pdb.gz	KCD11_MOUSE BTB/POZ domain-containing protein KCTD11 OS=Mus musculus OX=10090 GN=Kctd11 PE=1 SV=1
11	PDB:7lmaD	0.195	0.230	1.194E-1	187	0.068	0.086	7lmaD.pdb.gz	Structures of telomerase at several steps of telomere repeat synthesis.
12	AFDB:Q693B1	0.152	0.154	1.713E-1	232	0.077	0.078	Q693B1.pdb.gz	KCD11_HUMAN BTB/POZ domain-containing protein KCTD11 OS=Homo sapiens OX=9606 GN=KCTD11 PE=1 SV=1
13	PDB:3upuA	0.119	0.080	2.317E-1	439	0.043	0.023	3upuA.pdb.gz	The T4 Phage SF1B Helicase Dda Is Structurally Optimized to Perform DNA Strand Separation.
14	PDB:4v6wAX	0.218	0.333	2.777E-1	143	0.055	0.091	4v6wAX.pdb.gz	Structures of the human and Drosophila 80S ribosome.
15	PDB:6fhsE	0.104	0.064	2.949E-1	441	0.055	0.029	6fhsE.pdb.gz	Structural basis for ATP-dependent chromatin remodelling by the INO80 complex.
16	PDB:6ro1A	0.157	0.051	2.949E-1	919	0.085	0.022	6ro1A.pdb.gz	The MTR4 helicase recruits nuclear adaptors of the human RNA exosome using distinct arch-interacting motifs.
17	PDB:3jd5L	0.191	0.372	3.987E-1	109	0.047	0.101	3jd5L.pdb.gz	Cryo-EM structure of the small subunit of the mammalian mitochondrial ribosome.
18	PDB:5u6yA	0.123	0.068	4.498E-1	459	0.047	0.024	5u6yA.pdb.gz
19	PDB:4v6iBC	0.111	0.076	4.777E-1	388	0.085	0.052	4v6iBC.pdb.gz	Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.
20	PDB:4a2iL	0.141	0.256	5.389E-1	123	0.030	0.057	4a2iL.pdb.gz	Cryo-Electron Microscopy Structure of the 30S Subunit in Complex with the Yjeq Biogenesis Factor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y691	9.86e-179	491	235	1.000	1.000	KCMB2_HUMAN Calcium-activated potassium channel subunit beta-2 OS=Homo sapiens OX=9606 GN=KCNMB2 PE=1 SV=1
2	Q811Q0	1.40e-171	473	235	0.957	0.957	KCMB2_RAT Calcium-activated potassium channel subunit beta-2 OS=Rattus norvegicus OX=10116 GN=Kcnmb2 PE=2 SV=1
3	Q9NPA1	5.68e-59	189	279	0.400	0.337	KCMB3_HUMAN Calcium-activated potassium channel subunit beta-3 OS=Homo sapiens OX=9606 GN=KCNMB3 PE=1 SV=2
4	Q16558	5.89e-51	166	191	0.353	0.435	KCMB1_HUMAN Calcium-activated potassium channel subunit beta-1 OS=Homo sapiens OX=9606 GN=KCNMB1 PE=1 SV=5
5	P97678	9.92e-51	165	191	0.353	0.435	KCMB1_RAT Calcium-activated potassium channel subunit beta-1 OS=Rattus norvegicus OX=10116 GN=Kcnmb1 PE=2 SV=4
6	Q8CAE3	8.54e-46	152	191	0.353	0.435	KCMB1_MOUSE Calcium-activated potassium channel subunit beta-1 OS=Mus musculus OX=10090 GN=Kcnmb1 PE=1 SV=3
7	Q86W47	1.02e-33	122	210	0.277	0.310	KCMB4_HUMAN Calcium-activated potassium channel subunit beta-4 OS=Homo sapiens OX=9606 GN=KCNMB4 PE=1 SV=2
8	Q9ESK8	7.50e-33	120	210	0.285	0.319	KCMB4_RAT Calcium-activated potassium channel subunit beta-4 OS=Rattus norvegicus OX=10116 GN=Kcnmb4 PE=2 SV=1
9	Q9JIN6	3.15e-32	118	210	0.281	0.314	KCMB4_MOUSE Calcium-activated potassium channel subunit beta-4 OS=Mus musculus OX=10090 GN=Kcnmb4 PE=1 SV=1
10	Q8BKK5	1.3	32.7	500	0.119	0.056	ZN689_MOUSE Zinc finger protein 689 OS=Mus musculus OX=10090 GN=Znf689 PE=2 SV=1
11	Q9VZG8	2.5	31.6	448	0.094	0.049	Q9VZG8_DROME RT03134p OS=Drosophila melanogaster OX=7227 GN=Teh3 PE=2 SV=1
12	P98192	3.1	31.6	678	0.106	0.037	GNPAT_MOUSE Dihydroxyacetone phosphate acyltransferase OS=Mus musculus OX=10090 GN=Gnpat PE=1 SV=1
13	A1ZBE9	3.3	31.6	1022	0.077	0.018	A1ZBE9_DROME Methionine--tRNA ligase, cytoplasmic OS=Drosophila melanogaster OX=7227 GN=MetRS PE=1 SV=1
14	Q8MRS4	3.3	31.6	1012	0.077	0.018	Q8MRS4_DROME Methionine--tRNA ligase, cytoplasmic OS=Drosophila melanogaster OX=7227 GN=MetRS PE=2 SV=1
15	C0H520	7.0	30.4	1797	0.098	0.013	C0H520_PLAF7 Exoribonuclease II OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0906000 PE=4 SV=1
16	Q6P4A7	7.4	30.0	337	0.115	0.080	SFXN4_HUMAN Sideroflexin-4 OS=Homo sapiens OX=9606 GN=SFXN4 PE=1 SV=1
17	Q8I7Z8	8.7	30.0	990	0.106	0.025	HAM_DROME Transcription factor hamlet OS=Drosophila melanogaster OX=7227 GN=ham PE=2 SV=1
18	P40985	9.7	30.0	892	0.072	0.019	HUL4_YEAST Probable E3 ubiquitin-protein ligase HUL4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HUL4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12780 AAA_8	0.44	21.3	P-loop containing dynein motor region D4
2	PF03185 CaKB	6.4e-81	282.2	Calcium-activated potassium channel, beta subunit
3	PF09303 KcnmB2_inactiv	1.3e-15	68.1	KCNMB2, ball and chain domain
4	PF09334 tRNA-synt_1g	2.6	18.3	tRNA synthetases class I (M)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 89462.XP_006054371.1

Rank	PPI partner	STRING score	Description
1	89462.XP_006055621.1	0.928	Calcium-activated potassium channel subunit alpha-1-like
2	89462.XP_006042524.1	0.881	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins, and 18% coverage of the annotated genomic feature by RNAseq alignments
3	89462.XP_006057985.1	0.880	Small conductance calcium-activated potassium channel protein 1 isoform X1
4	89462.XP_006061010.1	0.872	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments
5	89462.XP_006048581.1	0.830	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 7 samples with support for all annotated introns
6	89462.XP_006050232.1	0.830	Small conductance calcium-activated potassium channel protein 2-like isoform X1
7	89462.XP_006058470.1	0.818	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 25 samples with support for all annotated introns
8	89462.XP_006075595.1	0.814	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 14 samples with support for all annotated introns
9	89462.XP_006054364.1	0.808	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 3 samples with support for all annotated introns
10	89462.XP_006072413.1	0.800	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
11	89462.XP_006057004.1	0.658	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 7 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
12	89462.XP_006053140.1	0.604	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 40 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments
13	89462.XP_006072560.1	0.604	Transmembrane protein 106B isoform X1
14	89462.XP_006059607.1	0.600	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 23 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 20 samples with support for all annotated introns
15	89462.XP_006066594.1	0.600	cAMP-dependent protein kinase catalytic subunit alpha
16	89462.XP_006068242.1	0.600	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
17	89462.XP_006071504.1	0.600	Voltage-dependent L-type calcium channel subunit alpha-1C-like
18	89462.XP_006073714.1	0.600	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 36 Proteins, and 61% coverage of the annotated genomic feature by RNAseq alignments
19	89462.XP_006078505.1	0.600	Voltage-dependent L-type calcium channel subunit alpha-1S isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0099106	1.000	ion channel regulator activity
GO:0005267	1.000	potassium channel activity
GO:0022839	0.999	monoatomic ion gated channel activity
GO:0015269	0.993	calcium-activated potassium channel activity
GO:0005488	0.982	binding
GO:0015459	0.982	potassium channel regulator activity
GO:0005515	0.973	protein binding
GO:0016248	0.626	channel inhibitor activity
GO:0008200	0.607	ion channel inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0003008	0.993	system process
GO:0030001	0.989	metal ion transport
GO:0009987	0.987	cellular process
GO:1902074	0.977	response to salt
GO:0065008	0.974	regulation of biological quality
GO:0006813	0.972	potassium ion transport
GO:0051592	0.969	response to calcium ion
GO:0042391	0.953	regulation of membrane potential
GO:0007154	0.949	cell communication
GO:0019229	0.949	regulation of vasoconstriction
GO:0009593	0.915	detection of chemical stimulus
GO:0001508	0.891	action potential
GO:0050877	0.877	nervous system process
GO:0019228	0.859	neuronal action potential
GO:0050794	0.519	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008076	0.999	voltage-gated potassium channel complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29463	1.000	K(+)(in) = K(+)(out)

[back to server]