StarFunc result for job id Q9Y697

User Input

>input (457 residues)
MLLRAAWRRAAVAVTAAPGPKPAAPTRGLRLRVGDRAPQSAVPADTAAAPEVGPVLRPLY
MDVQATTPLDPRVLDAMLPYLINYYGNPHSRTHAYGWESEAAMERARQQVASLIGADPRE
IIFTSGATESNNIAIKGVARFYRSRKKHLITTQTEHKCVLDSCRSLEAEGFQVTYLPVQK
SGIIDLKELEAAIQPDTSLVSVMTVNNEIGVKQPIAEIGRICSSRKVYFHTDAAQAVGKI
PLDVNDMKIDLMSISGHKIYGPKGVGAIYIRRRPRVRVEALQSGGGQERGMRSGTVPTPL
VVGLGAACEVAQQEMEYDHKRISKLSERLIQNIMKSLPDVVMNGDPKHHYPGCINLSFAY
VEGESLLMALKDVALSSGSACTSASLEPSYVLRAIGTDEDLAHSSIRFGIGRFTTEEEVD
YTVEKCIQHVKRLREMSPLWEMVQDGIDLKSIKWTQH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Z1J3	0.881	0.877	5.556E-85	459	0.912	0.908	Q9Z1J3.pdb.gz	NFS1_MOUSE Cysteine desulfurase OS=Mus musculus OX=10090 GN=Nfs1 PE=1 SV=3
2	AFDB:Q9VKD3	0.878	0.869	8.740E-74	462	0.700	0.693	Q9VKD3.pdb.gz	NFS1_DROME Cysteine desulfurase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Nfs1 PE=1 SV=1
3	AFDB:O74351	0.879	0.802	7.271E-70	501	0.615	0.561	O74351.pdb.gz	NFS1_SCHPO Probable cysteine desulfurase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC21D10.11c PE=3 SV=2
4	AFDB:P25374	0.871	0.801	6.268E-68	497	0.613	0.563	P25374.pdb.gz	NFS1_YEAST Cysteine desulfurase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NFS1 PE=1 SV=2
5	AFDB:O49543	0.878	0.886	2.168E-67	453	0.611	0.616	O49543.pdb.gz	MNIF1_ARATH Cysteine desulfurase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=NIFS1 PE=1 SV=1
6	AFDB:Q386Y7	0.888	0.929	5.658E-67	437	0.604	0.632	Q386Y7.pdb.gz	Q386Y7_TRYB2 cysteine desulfurase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.55.0013 PE=3 SV=1
7	AFDB:O31269	0.869	0.982	6.086E-60	404	0.501	0.567	O31269.pdb.gz	ISCS_AZOVI Cysteine desulfurase IscS OS=Azotobacter vinelandii OX=354 GN=iscS PE=1 SV=3
8	AFDB:P0A6B7	0.865	0.977	7.208E-60	404	0.527	0.597	P0A6B7.pdb.gz	ISCS_ECOLI Cysteine desulfurase IscS OS=Escherichia coli (strain K12) OX=83333 GN=iscS PE=1 SV=1
9	AFDB:Q8IBI5	0.850	0.703	1.341E-59	553	0.468	0.387	Q8IBI5.pdb.gz	Q8IBI5_PLAF7 Cysteine desulfurase, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0727200 PE=3 SV=1
10	PDB:3lvmB	0.831	0.963	8.994E-56	394	0.503	0.584	3lvmB.pdb.gz	Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions.
11	AFDB:Q72EB4	0.829	0.959	1.574E-49	394	0.396	0.459	Q72EB4.pdb.gz	Q72EB4_DESVH Cysteine desulfurase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_0664 PE=1 SV=1
12	PDB:4isyC	0.779	0.926	4.511E-41	383	0.322	0.384	4isyC.pdb.gz
13	PDB:3a9yA	0.783	0.885	2.593E-40	403	0.300	0.340	3a9yA.pdb.gz	Reaction mechanism and molecular basis for selenium/sulfur discrimination of selenocysteine lyase.
14	PDB:5wt6A	0.759	0.943	1.490E-39	366	0.339	0.423	5wt6A.pdb.gz	Structural snapshot of cysteine desulfurase NifS with L-cysteine in initiation of catalysis
15	PDB:3gzcA	0.793	0.896	8.096E-39	403	0.304	0.345	3gzcA.pdb.gz	Biochemical discrimination between selenium and sulfur 1: a single residue provides selenium specificity to human selenocysteine lyase.
16	PDB:4q75A	0.743	0.819	1.260E-28	413	0.219	0.242	4q75A.pdb.gz
17	PDB:6o11A	0.720	0.806	2.344E-28	406	0.190	0.214	6o11A.pdb.gz	Direct observation of intermediates in the SufS cysteine desulfurase reaction reveals functional roles of conserved active-site residues.
18	PDB:7cepA	0.735	0.808	4.360E-28	414	0.210	0.232	7cepA.pdb.gz	Cycloserine enantiomers inhibit PLP-dependent cysteine desulfurase SufS via distinct mechanisms.
19	PDB:5ft8A	0.716	0.810	9.269E-26	401	0.201	0.229	5ft8A.pdb.gz	Mechanism of Sulfur Transfer Across Protein-Protein Interfaces: The Cysteine Desulfurase Model System
20	PDB:3caiA	0.680	0.777	7.631E-23	396	0.149	0.172	3caiA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O49543	0.0	582	453	0.589	0.594	MNIF1_ARATH Cysteine desulfurase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=NIFS1 PE=1 SV=1
2	O74351	0.0	602	501	0.611	0.557	NFS1_SCHPO Probable cysteine desulfurase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC21D10.11c PE=3 SV=2
3	P0A6B7	0.0	531	404	0.530	0.599	ISCS_ECOLI Cysteine desulfurase IscS OS=Escherichia coli (strain K12) OX=83333 GN=iscS PE=1 SV=1
4	P0A6B9	0.0	531	404	0.530	0.599	ISCS_ECO57 Cysteine desulfurase IscS OS=Escherichia coli O157:H7 OX=83334 GN=iscS PE=1 SV=1
5	P25374	0.0	585	497	0.591	0.543	NFS1_YEAST Cysteine desulfurase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NFS1 PE=1 SV=2
6	Q386Y7	0.0	555	437	0.586	0.613	Q386Y7_TRYB2 cysteine desulfurase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.55.0013 PE=3 SV=1
7	Q5QP19	0.0	826	397	0.869	1.000	Q5QP19_HUMAN cysteine desulfurase OS=Homo sapiens OX=9606 GN=NFS1 PE=2 SV=1
8	Q9VKD3	0.0	689	462	0.687	0.680	NFS1_DROME Cysteine desulfurase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Nfs1 PE=1 SV=1
9	Q9Y697	0.0	944	457	1.000	1.000	NFS1_HUMAN Cysteine desulfurase OS=Homo sapiens OX=9606 GN=NFS1 PE=1 SV=3
10	Q9Z1J3	0.0	865	459	0.912	0.908	NFS1_MOUSE Cysteine desulfurase OS=Mus musculus OX=10090 GN=Nfs1 PE=1 SV=3
11	O31269	7.34e-168	480	404	0.501	0.567	ISCS_AZOVI Cysteine desulfurase IscS OS=Azotobacter vinelandii OX=354 GN=iscS PE=1 SV=3
12	Q8IBI5	3.76e-153	448	553	0.462	0.382	Q8IBI5_PLAF7 Cysteine desulfurase, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0727200 PE=3 SV=1
13	Q72EB4	3.04e-111	335	394	0.403	0.467	Q72EB4_DESVH Cysteine desulfurase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_0664 PE=1 SV=1
14	P05341	1.19e-103	316	402	0.361	0.410	NIFS_AZOVI Cysteine desulfurase NifS OS=Azotobacter vinelandii OX=354 GN=nifS PE=1 SV=4
15	O25008	6.36e-98	301	387	0.361	0.426	ISCS_HELPY Cysteine desulfurase IscS OS=Helicobacter pylori (strain ATCC 700392 / 26695) OX=85962 GN=iscS PE=1 SV=1
16	Q8WV90	1.36e-91	277	189	0.298	0.720	Q8WV90_HUMAN NFS1 cysteine desulfurase OS=Homo sapiens OX=9606 GN=NFS1 PE=1 SV=1
17	P9WQ71	4.73e-74	239	393	0.324	0.377	ISCSL_MYCTU IscS-like cysteine desulfurase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=iscS PE=1 SV=1
18	Q96I15	2.98e-64	216	445	0.322	0.330	SCLY_HUMAN Selenocysteine lyase OS=Homo sapiens OX=9606 GN=SCLY PE=1 SV=4
19	A0A0A0MQU4	3.33e-64	216	453	0.322	0.325	A0A0A0MQU4_HUMAN Selenocysteine lyase OS=Homo sapiens OX=9606 GN=SCLY PE=1 SV=1
20	Q68FT9	8.25e-63	211	432	0.319	0.338	SCLY_RAT Selenocysteine lyase OS=Rattus norvegicus OX=10116 GN=Scly PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00266 Aminotran_5	2.7e-89	311.3	Aminotransferase class-V
2	PF01212 Beta_elim_lyase	1.1e-05	36.5	Beta-eliminating lyase
3	PF01041 DegT_DnrJ_EryC1	0.023	25.5	DegT/DnrJ/EryC1/StrS aminotransferase family
4	PF00282 Pyridoxal_deC	46	14.2	Pyridoxal-dependent decarboxylase conserved domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363205

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000310623	0.999	Iron-sulfur cluster assembly enzyme ISCU, mitochondrial
2	9606.ENSP00000366482	0.999	Frataxin, mitochondrial
3	9606.ENSP00000420026	0.999	LYR motif-containing protein 4
4	9606.ENSP00000244051	0.998	Adenylyltransferase and sulfurtransferase MOCS3
5	9606.ENSP00000380402	0.997	3-mercaptopyruvate sulfurtransferase
6	9606.ENSP00000377311	0.992	Ferredoxin-2, mitochondrial
7	9606.ENSP00000260270	0.990	Adrenodoxin, mitochondrial
8	9606.ENSP00000216027	0.987	Iron-sulfur cluster co-chaperone protein HscB, mitochondrial
9	9606.ENSP00000387219	0.964	NFU1 iron-sulfur cluster scaffold homolog, mitochondrial
10	9606.ENSP00000385828	0.954	Thiosulfate sulfurtransferase
11	9606.ENSP00000365159	0.913	Iron-sulfur cluster assembly 1 homolog, mitochondrial
12	9606.ENSP00000452007	0.909	Iron-sulfur cluster assembly 2 homolog, mitochondrial
13	9606.ENSP00000390011	0.904	Cytoplasmic tRNA 2-thiolation protein 1
14	9606.ENSP00000328570	0.891	Glutaredoxin-related protein 5, mitochondrial
15	9606.ENSP00000283027	0.888	Cytosolic Fe-S cluster assembly factor NUBP1
16	9606.ENSP00000412922	0.888	Ubiquitin-related modifier 1
17	9606.ENSP00000355672	0.882	Putative transferase CAF17, mitochondrial
18	9606.ENSP00000416515	0.881	NADPH:adrenodoxin oxidoreductase, mitochondrial
19	9606.ENSP00000458770	0.880	Acyl carrier protein, mitochondrial
20	9606.ENSP00000253577	0.879	ATP-binding cassette sub-family B member 7, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016783	1.000	sulfurtransferase activity
GO:0042803	0.999	protein homodimerization activity
GO:0031071	0.937	cysteine desulfurase activity
GO:0097159	0.582	organic cyclic compound binding
GO:1901363	0.551	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016226	0.996	iron-sulfur cluster assembly
GO:0071704	0.995	organic substance metabolic process
GO:0043412	0.994	macromolecule modification
GO:1901564	0.993	organonitrogen compound metabolic process
GO:0044238	0.988	primary metabolic process
GO:0019538	0.978	protein metabolic process
GO:0036211	0.870	protein modification process
GO:1901360	0.497	organic cyclic compound metabolic process
GO:0046483	0.475	heterocycle metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.998	mitochondrion
GO:0031981	0.995	nuclear lumen
GO:0005654	0.985	nucleoplasm
GO:0032991	0.983	protein-containing complex
GO:0005829	0.971	cytosol
GO:0005759	0.964	mitochondrial matrix
GO:0098798	0.466	mitochondrial protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.8.1.-	1.000	Sulfurtransferases.
RHEA:43892	0.937	[sulfur carrier]-H + L-cysteine = [sulfur carrier]-SH + L-alanine
EC:2.8.1.7	0.937	cysteine desulfurase.

[back to server]