StarFunc result for job id Q9Y698

User Input

>input (323 residues)
MGLFDRGVQMLLTTVGAFAAFSLMTIAVGTDYWLYSRGVCKTKSVSENETSKKNEEVMTH
SGLWRTCCLEGNFKGLCKQIDHFPEDADYEADTAEYFLRAVRASSIFPILSVILLFMGGL
CIAASEFYKTRHNIILSAGIFFVSAGLSNIIGIIVYISANAGDPSKSDSKKNSYSYGWSF
YFGALSFIIAEMVGVLAVHMFIDRHKQLRATARATDYLQASAITRIPSYRYRYQRRSRSS
SRSTEPSHSRDASPVGIKGFNTLPSTEISMYTLSRDPLKAATTPTATYNSDRDNSFLQVH
NCIQKENKDSLHSNTANRRTTPV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O88602	0.819	0.819	1.582E-46	323	0.988	0.988	O88602.pdb.gz	CCG2_MOUSE Voltage-dependent calcium channel gamma-2 subunit OS=Mus musculus OX=10090 GN=Cacng2 PE=1 SV=1
2	AFDB:Q6PFS3	0.727	0.725	2.828E-45	324	0.895	0.892	Q6PFS3.pdb.gz	Q6PFS3_DANRE Voltage-dependent calcium channel gamma-2 subunit OS=Danio rerio OX=7955 GN=cacng2 PE=2 SV=1
3	AFDB:O60359	0.695	0.711	9.565E-40	315	0.746	0.765	O60359.pdb.gz	CCG3_HUMAN Voltage-dependent calcium channel gamma-3 subunit OS=Homo sapiens OX=9606 GN=CACNG3 PE=2 SV=1
4	AFDB:Q8VHW9	0.666	0.659	7.462E-32	327	0.573	0.566	Q8VHW9.pdb.gz	CCG4_RAT Voltage-dependent calcium channel gamma-4 subunit OS=Rattus norvegicus OX=10116 GN=Cacng4 PE=1 SV=1
5	AFDB:Q8WXS5	0.633	0.485	1.409E-30	425	0.576	0.438	Q8WXS5.pdb.gz	CCG8_HUMAN Voltage-dependent calcium channel gamma-8 subunit OS=Homo sapiens OX=9606 GN=CACNG8 PE=2 SV=3
6	PDB:5weoA	0.558	0.188	1.025E-22	988	0.588	0.192	5weoA.pdb.gz	Channel opening and gating mechanism in AMPA-subtype glutamate receptors.
7	PDB:5kbtA	0.491	0.178	5.743E-21	973	0.585	0.194	5kbtA.pdb.gz	Elucidation of AMPA receptor-stargazin complexes by cryo-electron microscopy.
8	PDB:7ocaI	0.539	0.930	2.007E-20	185	0.378	0.659	7ocaI.pdb.gz	Gating and modulation of a hetero-octameric AMPA glutamate receptor.
9	AFDB:Q8VHW8	0.501	0.584	4.145E-17	275	0.257	0.302	Q8VHW8.pdb.gz	CCG5_RAT Voltage-dependent calcium channel gamma-5 subunit OS=Rattus norvegicus OX=10116 GN=Cacng5 PE=1 SV=1
10	AFDB:P62955	0.527	0.613	3.277E-16	275	0.254	0.298	P62955.pdb.gz	CCG7_HUMAN Voltage-dependent calcium channel gamma-7 subunit OS=Homo sapiens OX=9606 GN=CACNG7 PE=1 SV=1
11	PDB:7rz4A	0.476	0.164	2.209E-13	993	0.207	0.067	7rz4A.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
12	PDB:5kk2E	0.425	0.716	1.947E-12	173	0.498	0.931	5kk2E.pdb.gz
13	AFDB:G5EDT2	0.519	0.463	4.473E-12	366	0.201	0.178	G5EDT2.pdb.gz	G5EDT2_CAEEL STarGazin (Mammalian calcium channel) homolog OS=Caenorhabditis elegans OX=6239 GN=stg-1 PE=2 SV=1
14	AFDB:Q9N419	0.424	0.446	7.723E-9	303	0.127	0.135	Q9N419.pdb.gz	Q9N419_CAEEL Clc-like protein OS=Caenorhabditis elegans OX=6239 GN=nsy-4 PE=1 SV=3
15	AFDB:G5EBI8	0.494	0.450	1.484E-8	357	0.102	0.092	G5EBI8.pdb.gz	G5EBI8_CAEEL STarGazin (Mammalian calcium channel) homolog OS=Caenorhabditis elegans OX=6239 GN=stg-2 PE=2 SV=1
16	PDB:7rzaA	0.469	0.164	1.359E-7	981	0.127	0.042	7rzaA.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
17	PDB:5b2gC	0.407	0.378	4.500E-7	350	0.096	0.089	5b2gC.pdb.gz
18	PDB:6jp5E	0.397	0.727	1.411E-6	169	0.111	0.213	6jp5E.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
19	PDB:6ov2A	0.408	0.691	2.302E-6	182	0.102	0.181	6ov2A.pdb.gz
20	PDB:7d3eB	0.345	0.397	4.115E-5	272	0.065	0.077	7d3eB.pdb.gz	Structures of human dual oxidase 1 complex in low-calcium and high-calcium states.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O88602	0.0	668	323	0.988	0.988	CCG2_MOUSE Voltage-dependent calcium channel gamma-2 subunit OS=Mus musculus OX=10090 GN=Cacng2 PE=1 SV=1
2	Q6PFS3	0.0	562	324	0.895	0.892	Q6PFS3_DANRE Voltage-dependent calcium channel gamma-2 subunit OS=Danio rerio OX=7955 GN=cacng2 PE=2 SV=1
3	Q71RJ2	0.0	668	323	0.988	0.988	CCG2_RAT Voltage-dependent calcium channel gamma-2 subunit OS=Rattus norvegicus OX=10116 GN=Cacng2 PE=1 SV=1
4	Q9Y698	0.0	674	323	1.000	1.000	CCG2_HUMAN Voltage-dependent calcium channel gamma-2 subunit OS=Homo sapiens OX=9606 GN=CACNG2 PE=1 SV=1
5	O60359	1.10e-164	462	315	0.731	0.749	CCG3_HUMAN Voltage-dependent calcium channel gamma-3 subunit OS=Homo sapiens OX=9606 GN=CACNG3 PE=2 SV=1
6	Q8VHX0	4.08e-163	459	315	0.728	0.746	CCG3_RAT Voltage-dependent calcium channel gamma-3 subunit OS=Rattus norvegicus OX=10116 GN=Cacng3 PE=1 SV=1
7	Q9JJV5	4.08e-163	459	315	0.728	0.746	CCG3_MOUSE Voltage-dependent calcium channel gamma-3 subunit OS=Mus musculus OX=10090 GN=Cacng3 PE=1 SV=2
8	Q8VHW9	4.02e-112	330	327	0.591	0.584	CCG4_RAT Voltage-dependent calcium channel gamma-4 subunit OS=Rattus norvegicus OX=10116 GN=Cacng4 PE=1 SV=1
9	Q9JJV4	2.77e-111	328	327	0.588	0.581	CCG4_MOUSE Voltage-dependent calcium channel gamma-4 subunit OS=Mus musculus OX=10090 GN=Cacng4 PE=1 SV=1
10	Q9UBN1	3.26e-111	327	327	0.588	0.581	CCG4_HUMAN Voltage-dependent calcium channel gamma-4 subunit OS=Homo sapiens OX=9606 GN=CACNG4 PE=1 SV=1
11	Q8VHW5	3.93e-100	303	421	0.520	0.399	CCG8_RAT Voltage-dependent calcium channel gamma-8 subunit OS=Rattus norvegicus OX=10116 GN=Cacng8 PE=1 SV=1
12	Q8VHW2	1.12e-99	301	423	0.517	0.395	CCG8_MOUSE Voltage-dependent calcium channel gamma-8 subunit OS=Mus musculus OX=10090 GN=Cacng8 PE=1 SV=1
13	Q8WXS5	1.19e-96	294	425	0.551	0.419	CCG8_HUMAN Voltage-dependent calcium channel gamma-8 subunit OS=Homo sapiens OX=9606 GN=CACNG8 PE=2 SV=3
14	Q9UF02	3.67e-32	122	275	0.211	0.247	CCG5_HUMAN Voltage-dependent calcium channel gamma-5 subunit OS=Homo sapiens OX=9606 GN=CACNG5 PE=2 SV=2
15	Q8VHW8	7.38e-32	122	275	0.204	0.240	CCG5_RAT Voltage-dependent calcium channel gamma-5 subunit OS=Rattus norvegicus OX=10116 GN=Cacng5 PE=1 SV=1
16	P62955	1.86e-29	115	275	0.207	0.244	CCG7_HUMAN Voltage-dependent calcium channel gamma-7 subunit OS=Homo sapiens OX=9606 GN=CACNG7 PE=1 SV=1
17	P62956	1.86e-29	115	275	0.207	0.244	CCG7_MOUSE Voltage-dependent calcium channel gamma-7 subunit OS=Mus musculus OX=10090 GN=Cacng7 PE=1 SV=1
18	P62957	1.86e-29	115	275	0.207	0.244	CCG7_RAT Voltage-dependent calcium channel gamma-7 subunit OS=Rattus norvegicus OX=10116 GN=Cacng7 PE=1 SV=1
19	Q9VRE6	5.07e-10	62.4	447	0.198	0.143	Q9VRE6_DROME GH12419p1 OS=Drosophila melanogaster OX=7227 GN=stg1 PE=2 SV=3
20	G5EDT2	2.55e-07	53.9	366	0.183	0.161	G5EDT2_CAEEL STarGazin (Mammalian calcium channel) homolog OS=Caenorhabditis elegans OX=6239 GN=stg-1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13903 Claudin_2	8.2e-18	76.4	PMP-22/EMP/MP20/Claudin tight junction
2	PF00822 PMP22_Claudin	3.3e-54	194.7	PMP-22/EMP/MP20/Claudin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 89462.XP_006057034.1

Rank	PPI partner	STRING score	Description
1	89462.XP_006078267.1	0.998	Glutamate receptor 2 isoform X1
2	89462.XP_006045608.1	0.995	Glutamate receptor 1-like isoform X1
3	89462.XP_006063305.1	0.995	Glutamate receptor 1-like
4	89462.XP_006065050.1	0.991	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 16 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
5	89462.XP_006048319.1	0.986	Disks large homolog 4-like
6	89462.XP_006052975.1	0.986	Glutamate receptor 4-like
7	89462.XP_006060202.1	0.986	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 14 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 18 samples with support for all annotated introns
8	89462.XP_006074270.1	0.976	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 12 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 3 samples with support for all annotated introns
9	89462.XP_006073700.1	0.967	Protein shisa-9
10	89462.XP_006056597.1	0.963	Uncharacterized protein LOC102392623
11	89462.XP_006062604.1	0.962	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred complete CDS: substituted 1 base at 1 genomic stop codon
12	89462.XP_006063455.1	0.959	Glutamate receptor ionotropic, NMDA 2A-like
13	89462.XP_006062802.1	0.958	Protein cornichon homolog 3 isoform X1
14	89462.XP_006052671.1	0.950	Glutamate receptor ionotropic, kainate 1
15	89462.XP_006041324.1	0.947	Glutamate receptor ionotropic, kainate 5
16	89462.XP_006045405.1	0.944	Glutamate receptor ionotropic, NMDA 2C
17	89462.XP_006044961.1	0.942	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments
18	89462.XP_006050545.1	0.940	Glutamate receptor ionotropic, NMDA 3B
19	89462.XP_006080883.1	0.939	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred complete CDS: inserted 1 base in 1 codon
20	89462.XP_006067431.1	0.933	Glutamate receptor ionotropic, NMDA 2B-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005245	1.000	voltage-gated calcium channel activity
GO:0005102	0.691	signaling receptor binding
GO:0035254	0.683	glutamate receptor binding
GO:0035255	0.673	ionotropic glutamate receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0010646	0.988	regulation of cell communication
GO:0023051	0.987	regulation of signaling
GO:0051049	0.975	regulation of transport
GO:0048583	0.972	regulation of response to stimulus
GO:0009966	0.957	regulation of signal transduction
GO:0050896	0.953	response to stimulus
GO:0051179	0.937	localization
GO:0032409	0.932	regulation of transporter activity
GO:0051234	0.927	establishment of localization
GO:0034762	0.926	regulation of transmembrane transport
GO:0006810	0.924	transport
GO:0099601	0.907	regulation of neurotransmitter receptor activity
GO:0023052	0.881	signaling
GO:0007154	0.879	cell communication
GO:0022898	0.852	regulation of transmembrane transporter activity
GO:0032412	0.774	regulation of monoatomic ion transmembrane transporter activity
GO:0007165	0.766	signal transduction
GO:0071702	0.751	organic substance transport
GO:0072657	0.605	protein localization to membrane
GO:0032501	0.573	multicellular organismal process
GO:0065008	0.565	regulation of biological quality
GO:0045184	0.519	establishment of protein localization
GO:0015031	0.503	protein transport
GO:0048518	0.502	positive regulation of biological process
GO:0046907	0.446	intracellular transport
GO:1990778	0.432	protein localization to cell periphery
GO:0043269	0.419	regulation of monoatomic ion transport
GO:0044093	0.417	positive regulation of molecular function
GO:0048522	0.411	positive regulation of cellular process
GO:0006886	0.411	intracellular protein transport
GO:0031503	0.403	protein-containing complex localization
GO:0034765	0.392	regulation of monoatomic ion transmembrane transport
GO:0099072	0.342	regulation of postsynaptic membrane neurotransmitter receptor levels
GO:1902414	0.335	protein localization to cell junction
GO:0043270	0.313	positive regulation of monoatomic ion transport
GO:2000273	0.305	positive regulation of signaling receptor activity
GO:0032414	0.301	positive regulation of ion transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.999	organelle
GO:0098797	0.998	plasma membrane protein complex
GO:0034702	0.998	ion channel complex
GO:0005622	0.995	intracellular anatomical structure
GO:0030054	0.994	cell junction
GO:0005737	0.993	cytoplasm
GO:0043227	0.990	membrane-bounded organelle
GO:0043231	0.983	intracellular membrane-bounded organelle
GO:0005829	0.978	cytosol
GO:0031090	0.971	organelle membrane
GO:0045202	0.965	synapse
GO:0031982	0.954	vesicle
GO:0043235	0.947	receptor complex
GO:0099634	0.926	postsynaptic specialization membrane
GO:0032281	0.926	AMPA glutamate receptor complex
GO:0098984	0.925	neuron to neuron synapse
GO:0098839	0.914	postsynaptic density membrane
GO:0098978	0.823	glutamatergic synapse
GO:0030139	0.471	endocytic vesicle
GO:0098588	0.459	bounding membrane of organelle
GO:0120025	0.426	plasma membrane bounded cell projection
GO:0012505	0.417	endomembrane system
GO:0036477	0.406	somatodendritic compartment
GO:0030659	0.382	cytoplasmic vesicle membrane
GO:0030666	0.372	endocytic vesicle membrane
GO:0043005	0.353	neuron projection
GO:0005634	0.336	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	1.000	Ca(2+)(in) = Ca(2+)(out)

[back to server]