StarFunc result for job id Q9Y6A1

User Input

>input (747 residues)
MWGFLKRPVVVTADINLSLVALTGMGLLSRLWRLTYPRAVVFDEVYYGQYISFYMKQIFF
LDDSGPPFGHMVLALGGYLGGFDGNFLWNRIGAEYSSNVPVWSLRLLPALAGALSVPMAY
QIVLELHFSHCAAMGAALLMLIENALITQSRLMLLESVLIFFNLLAVLSYLKFFNCQKHS
PFSLSWWFWLTLTGVACSCAVGIKYMGVFTYVLVLGVAAVHAWHLLGDQTLSNVGADVQC
CMRPACMGQMQMSQGVCVFCHLLARAVALLVIPVVLYLLFFYVHLILVFRSGPHDQIMSS
AFQASLEGGLARITQGQPLEVAFGSQVTLRNVFGKPVPCWLHSHQDTYPMIYENGRGSSH
QQQVTCYPFKDVNNWWIVKDPRRHQLVVSSPPRPVRHGDMVQLVHGMTTRSLNTHDVAAP
LSPHSQEVSCYIDYNISMPAQNLWRLEIVNRGSDTDVWKTILSEVRFVHVNTSAVLKLSG
AHLPDWGYRQLEIVGEKLSRGYHGSTVWNVEEHRYGASQEQRERERELHSPAQVDVSRNL
SFMARFSELQWRMLALRSDDSEHKYSSSPLEWVTLDTNIAYWLHPRTSAQIHLLGNIVIW
VSGSLALAIYALLSLWYLLRRRRNVHDLPQDAWLRWVLAGALCAGGWAVNYLPFFLMEKT
LFLYHYLPALTFQILLLPVVLQHISDHLCRSQLQRSIFSALVVAWYSSACHVSNTLRPLT
YGDKSLSPHELKALRWKDSWDILIRKH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y6A1	1.000	1.000	0.000	747	1.000	1.000	Q9Y6A1.pdb.gz	POMT1_HUMAN Protein O-mannosyl-transferase 1 OS=Homo sapiens OX=9606 GN=POMT1 PE=1 SV=3
2	AFDB:Q99PR0	0.961	0.961	1.003E-102	747	0.827	0.827	Q99PR0.pdb.gz	POMT1_RAT Protein O-mannosyl-transferase 1 OS=Rattus norvegicus OX=10116 GN=Pomt1 PE=2 SV=1
3	AFDB:F1QF89	0.950	0.985	3.213E-91	720	0.647	0.671	F1QF89.pdb.gz	POMT1_DANRE Protein O-mannosyl-transferase 1 OS=Danio rerio OX=7955 GN=pomt1 PE=1 SV=1
4	AFDB:Q9VTK2	0.929	0.785	8.900E-69	886	0.418	0.352	Q9VTK2.pdb.gz	POMT1_DROME Protein O-mannosyltransferase 1 OS=Drosophila melanogaster OX=7227 GN=rt PE=2 SV=2
5	AFDB:F1Q8R9	0.776	0.767	1.137E-49	756	0.325	0.321	F1Q8R9.pdb.gz	POMT2_DANRE Protein O-mannosyl-transferase 2 OS=Danio rerio OX=7955 GN=pomt2 PE=1 SV=1
6	AFDB:Q5BDC1	0.764	0.740	2.606E-49	773	0.325	0.314	Q5BDC1.pdb.gz	Q5BDC1_EMENI Dolichyl-phosphate-mannose--protein mannosyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01459 PE=3 SV=1
7	AFDB:O42933	0.819	0.789	2.843E-49	778	0.307	0.294	O42933.pdb.gz	PMT4_SCHPO Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm4 PE=3 SV=1
8	AFDB:Q9UKY4	0.772	0.769	4.801E-49	750	0.316	0.315	Q9UKY4.pdb.gz	POMT2_HUMAN Protein O-mannosyl-transferase 2 OS=Homo sapiens OX=9606 GN=POMT2 PE=1 SV=2
9	AFDB:Q4WCG5	0.753	0.724	1.149E-48	780	0.324	0.310	Q4WCG5.pdb.gz	Q4WCG5_ASPFU Dolichyl-phosphate-mannose--protein mannosyltransferase OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_8G04500 PE=3 SV=1
10	AFDB:Q59X23	0.700	0.693	1.149E-48	755	0.323	0.319	Q59X23.pdb.gz	PMT4_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT4 PE=2 SV=2
11	PDB:6p25B	0.783	0.844	1.377E-41	690	0.280	0.303	6p25B.pdb.gz	Structure of the eukaryotic protein O-mannosyltransferase Pmt1-Pmt2 complex.
12	PDB:6p25A	0.804	0.820	3.479E-40	731	0.274	0.280	6p25A.pdb.gz	Structure of the eukaryotic protein O-mannosyltransferase Pmt1-Pmt2 complex.
13	PDB:1t9fA	0.212	0.821	3.262E-9	178	0.066	0.275	1t9fA.pdb.gz
14	PDB:3malA	0.219	0.841	3.262E-9	181	0.078	0.320	3malA.pdb.gz
15	PDB:7t3rA	0.193	0.074	1.787E-4	2130	0.067	0.023	7t3rA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
16	PDB:7t3qA	0.185	0.072	3.440E-4	2103	0.063	0.022	7t3qA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
17	PDB:7t65A	0.182	0.035	5.095E-4	4252	0.037	0.007	7t65A.pdb.gz	Molecular mechanism of the severe MH/CCD mutation Y522S in skeletal ryanodine receptor (RyR1) by cryo-EM.
18	PDB:5t15B	0.184	0.036	6.067E-4	4170	0.036	0.006	5t15B.pdb.gz	Structural Basis for Gating and Activation of RyR1.
19	PDB:7rroE	0.189	0.493	1.118E-3	255	0.037	0.110	7rroE.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
20	PDB:7tdgA	0.186	0.037	1.517E-3	4134	0.035	0.006	7tdgA.pdb.gz	Ca 2+ -inactivation of the mammalian ryanodine receptor type 1 in a lipidic environment revealed by cryo-EM.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1QF89	0.0	1024	720	0.648	0.672	POMT1_DANRE Protein O-mannosyl-transferase 1 OS=Danio rerio OX=7955 GN=pomt1 PE=1 SV=1
2	Q8R2R1	0.0	1256	746	0.834	0.835	POMT1_MOUSE Protein O-mannosyl-transferase 1 OS=Mus musculus OX=10090 GN=Pomt1 PE=1 SV=1
3	Q99PR0	0.0	1272	747	0.830	0.830	POMT1_RAT Protein O-mannosyl-transferase 1 OS=Rattus norvegicus OX=10116 GN=Pomt1 PE=2 SV=1
4	Q9VTK2	0.0	619	886	0.422	0.356	POMT1_DROME Protein O-mannosyltransferase 1 OS=Drosophila melanogaster OX=7227 GN=rt PE=2 SV=2
5	Q9Y6A1	0.0	1535	747	1.000	1.000	POMT1_HUMAN Protein O-mannosyl-transferase 1 OS=Homo sapiens OX=9606 GN=POMT1 PE=1 SV=3
6	Q5BDC1	8.03e-118	374	773	0.333	0.322	Q5BDC1_EMENI Dolichyl-phosphate-mannose--protein mannosyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01459 PE=3 SV=1
7	Q4WCG5	1.84e-112	360	780	0.331	0.317	Q4WCG5_ASPFU Dolichyl-phosphate-mannose--protein mannosyltransferase OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_8G04500 PE=3 SV=1
8	G5EB59	1.02e-105	342	740	0.307	0.309	G5EB59_EMENI Dolichyl-phosphate-mannose--protein mannosyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05105 PE=3 SV=1
9	Q59X23	3.23e-105	340	755	0.329	0.326	PMT4_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT4 PE=2 SV=2
10	F1Q8R9	3.71e-103	335	756	0.327	0.323	POMT2_DANRE Protein O-mannosyl-transferase 2 OS=Danio rerio OX=7955 GN=pomt2 PE=1 SV=1
11	Q4WWN0	8.15e-100	331	946	0.324	0.256	Q4WWN0_ASPFU Dolichyl-phosphate-mannose--protein mannosyltransferase OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_3G06450 PE=3 SV=1
12	Q9UKY4	1.37e-99	325	750	0.324	0.323	POMT2_HUMAN Protein O-mannosyl-transferase 2 OS=Homo sapiens OX=9606 GN=POMT2 PE=1 SV=2
13	Q14U74	1.72e-97	322	820	0.325	0.296	Q14U74_RAT Dolichyl-phosphate-mannose--protein mannosyltransferase OS=Rattus norvegicus OX=10116 GN=Pomt2 PE=3 SV=1
14	P46971	5.02e-91	303	762	0.304	0.298	PMT4_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT4 PE=1 SV=1
15	O42933	6.35e-91	303	778	0.313	0.301	PMT4_SCHPO Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm4 PE=3 SV=1
16	P31382	2.70e-89	298	759	0.309	0.304	PMT2_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT2 PE=1 SV=2
17	Q5ADM9	1.55e-88	296	769	0.289	0.281	PMT2_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT2 PE=1 SV=1
18	Q6FUT7	6.06e-88	294	734	0.300	0.305	Q6FUT7_CANGA Dolichyl-phosphate-mannose--protein mannosyltransferase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0F00759g PE=3 SV=1
19	O74189	5.08e-82	281	877	0.292	0.249	PMT1_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT1 PE=2 SV=1
20	Q9W5D4	1.12e-81	278	765	0.301	0.294	POMT2_DROME Protein O-mannosyl-transferase 2 OS=Drosophila melanogaster OX=7227 GN=tw PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02815 MIR	1.3e-11	56.3	MIR domain
2	PF02366 PMT	1.2e-92	321.5	Dolichyl-phosphate-mannose-protein mannosyltransferase
3	PF16192 PMT_4TMC	1.3e-47	173.6	C-terminal four TMM region of protein-O-mannosyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361302

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361060	0.995	Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1
2	9606.ENSP00000344125	0.993	Protein O-linked-mannose beta-1,4-N-acetylglucosaminyltransferase 2
3	9606.ENSP00000357384	0.987	Dolichol-phosphate mannosyltransferase subunit 3
4	9606.ENSP00000442600	0.987	Dystroglycan
5	9606.ENSP00000360644	0.985	Dolichol-phosphate mannosyltransferase subunit 1
6	9606.ENSP00000322181	0.982	Dolichol phosphate-mannose biosynthesis regulatory protein
7	9606.ENSP00000223528	0.956	Fukutin
8	9606.ENSP00000331258	0.918	Protein O-mannose kinase
9	9606.ENSP00000326570	0.915	Fukutin-related protein
10	9606.ENSP00000261534	0.905	Protein O-mannosyl-transferase 2
11	9606.ENSP00000261234	0.891	UDP-D-xylose:ribitol-5-phosphate beta1,4-xylosyltransferase
12	9606.ENSP00000355559	0.886	UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 2
13	9606.ENSP00000385478	0.879	D-ribitol-5-phosphate cytidylyltransferase
14	9606.ENSP00000361667	0.874	Dolichol kinase
15	9606.ENSP00000309092	0.840	Mannose-1-phosphate guanyltransferase beta
16	9606.ENSP00000309096	0.812	Beta-1,4-glucuronyltransferase 1
17	9606.ENSP00000432869	0.793	LARGE xylosyl- and glucuronyltransferase 2
18	9606.ENSP00000347088	0.727	LARGE xylosyl- and glucuronyltransferase 1
19	9606.ENSP00000247020	0.722	Stromal cell derived factor 2
20	9606.ENSP00000363827	0.711	Basement membrane-specific heparan sulfate proteoglycan core protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000030	1.000	mannosyltransferase activity
GO:0005515	0.999	protein binding
GO:0004169	0.944	dolichyl-phosphate-mannose-protein mannosyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0006486	0.991	protein glycosylation
GO:0006493	0.979	protein O-linked glycosylation
GO:0097502	0.957	mannosylation
GO:0035268	0.925	protein mannosylation
GO:0065007	0.446	biological regulation
GO:0050789	0.360	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005783	1.000	endoplasmic reticulum
GO:0031984	0.892	organelle subcompartment
GO:0031090	0.890	organelle membrane
GO:0042175	0.847	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0098827	0.845	endoplasmic reticulum subcompartment
GO:0005789	0.840	endoplasmic reticulum membrane
GO:0031982	0.538	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.
EC:2.4.1.109	0.944	dolichyl-phosphate-mannose--protein mannosyltransferase.

[back to server]