StarFunc result for job id Q9Y6A5

User Input

>input (838 residues)
MSLQVLNDKNVSNEKNTENCDFLFSPPEVTGRSSVLRVSQKENVPPKNLAKAMKVTFQTP
LRDPQTHRILSPSMASKLEAPFTQDDTLGLENSHPVWTQKENQQLIKEVDAKTTHGILQK
PVEADTDLLGDASPAFGSGSSSESGPGALADLDCSSSSQSPGSSENQMVSPGKVSGSPEQ
AVEENLSSYSLDRRVTPASETLEDPCRTESQHKAETPHGAEEECKAETPHGAEEECRHGG
VCAPAAVATSPPGAIPKEACGGAPLQGLPGEALGCPAGVGTPVPADGTQTLTCAHTSAPE
STAPTNHLVAGRAMTLSPQEEVAAGQMASSSRSGPVKLEFDVSDGATSKRAPPPRRLGER
SGLKPPLRKAAVRQQKAPQEVEEDDGRSGAGEDPPMPASRGSYHLDWDKMDDPNFIPFGG
DTKSGCSEAQPPESPETRLGQPAAEQLHAGPATEEPGPCLSQQLHSASAEDTPVVQLAAE
TPTAESKERALNSASTSLPTSCPGSEPVPTHQQGQPALELKEESFRDPAEVLGTGAEVDY
LEQFGTSSFKESALRKQSLYLKFDPLLRDSPGRPVPVATETSSMHGANETPSGRPREAKL
VEFDFLGALDIPVPGPPPGVPAPGGPPLSTGPIVDLLQYSQKDLDAVVKATQEENRELRS
RCEELHGKNLELGKIMDRFEEVVYQAMEEVQKQKELSKAEIQKVLKEKDQLTTDLNSMEK
SFSDLFKRFEKQKEVIEGYRKNEESLKKCVEDYLARITQEGQRYQALKAHAEEKLQLANE
EIAQVRSKAQAEALALQASLRKEQMRIQSLEKTVEQKTKENEELTRICDDLISKMEKI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y6A5	1.000	1.000	0.000	838	1.000	1.000	Q9Y6A5.pdb.gz	TACC3_HUMAN Transforming acidic coiled-coil-containing protein 3 OS=Homo sapiens OX=9606 GN=TACC3 PE=1 SV=1
2	AFDB:Q9PTG8	0.276	0.252	2.146E-35	931	0.376	0.338	Q9PTG8.pdb.gz	TACC3_XENLA Transforming acidic coiled-coil-containing protein 3 OS=Xenopus laevis OX=8355 GN=tacc3 PE=1 SV=2
3	AFDB:O75410	0.212	0.220	2.527E-17	805	0.245	0.255	O75410.pdb.gz	TACC1_HUMAN Transforming acidic coiled-coil-containing protein 1 OS=Homo sapiens OX=9606 GN=TACC1 PE=1 SV=2
4	AFDB:D6RAA5	0.221	0.185	1.132E-15	1008	0.297	0.247	D6RAA5.pdb.gz	D6RAA5_HUMAN Transforming acidic coiled-coil containing protein 2 OS=Homo sapiens OX=9606 GN=TACC2 PE=1 SV=1
5	AFDB:Q4VXL8	0.225	0.183	1.427E-14	1038	0.301	0.243	Q4VXL8.pdb.gz	Q4VXL8_HUMAN Transforming acidic coiled-coil containing protein 2 OS=Homo sapiens OX=9606 GN=TACC2 PE=1 SV=1
6	AFDB:Q9JJG0	0.210	0.157	7.208E-14	1149	0.282	0.205	Q9JJG0.pdb.gz	TACC2_MOUSE Transforming acidic coiled-coil-containing protein 2 OS=Mus musculus OX=10090 GN=Tacc2 PE=1 SV=2
7	AFDB:Q6Y685	0.212	0.227	7.360E-13	774	0.226	0.244	Q6Y685.pdb.gz	TACC1_MOUSE Transforming acidic coiled-coil-containing protein 1 OS=Mus musculus OX=10090 GN=Tacc1 PE=1 SV=1
8	AFDB:R4GMT7	0.045	0.061	1.527E-4	580	0.144	0.209	R4GMT7.pdb.gz	R4GMT7_HUMAN Transforming acidic coiled-coil containing protein 1 OS=Homo sapiens OX=9606 GN=TACC1 PE=1 SV=1
9	AFDB:Q0WR66	0.164	0.172	6.698E-4	793	0.161	0.170	Q0WR66.pdb.gz	ASY3_ARATH Meiosis-specific protein ASY3 OS=Arabidopsis thaliana OX=3702 GN=ASY3 PE=1 SV=1
10	AFDB:Q9UPV0	0.118	0.081	5.941E-3	1460	0.173	0.099	Q9UPV0.pdb.gz	CE164_HUMAN Centrosomal protein of 164 kDa OS=Homo sapiens OX=9606 GN=CEP164 PE=1 SV=3
11	PDB:7pubDJ	0.043	0.087	6.658	357	0.006	0.014	7pubDJ.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
12	PDB:6gawAp	0.029	0.082	9.467	190	0.019	0.084	6gawAp.pdb.gz	Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM.
13	PDB:6rw4O	0.033	0.093	9.467	194	0.014	0.062	6rw4O.pdb.gz	Distinct pre-initiation steps in human mitochondrial translation.
14	PDB:6v8oF	0.027	0.196	9.467	67	0.010	0.119	6v8oF.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
15	PDB:7rroF0	0.061	0.315	9.467	139	0.013	0.079	7rroF0.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A494BZT8	0.0	1683	834	0.995	1.000	A0A494BZT8_HUMAN Transforming acidic coiled-coil containing protein 3 OS=Homo sapiens OX=9606 GN=TACC3 PE=1 SV=1
2	E7EMT0	0.0	556	272	0.325	1.000	E7EMT0_HUMAN Transforming acidic coiled-coil containing protein 3 (Fragment) OS=Homo sapiens OX=9606 GN=TACC3 PE=1 SV=3
3	Q9Y6A5	0.0	1701	838	1.000	1.000	TACC3_HUMAN Transforming acidic coiled-coil-containing protein 3 OS=Homo sapiens OX=9606 GN=TACC3 PE=1 SV=1
4	C9JA91	1.45e-161	471	230	0.274	1.000	C9JA91_HUMAN Transforming acidic coiled-coil containing protein 3 (Fragment) OS=Homo sapiens OX=9606 GN=TACC3 PE=1 SV=8
5	Q9JJ11	1.13e-142	437	631	0.276	0.366	TACC3_MOUSE Transforming acidic coiled-coil-containing protein 3 OS=Mus musculus OX=10090 GN=Tacc3 PE=1 SV=1
6	Q9PTG8	1.68e-117	380	931	0.296	0.266	TACC3_XENLA Transforming acidic coiled-coil-containing protein 3 OS=Xenopus laevis OX=8355 GN=tacc3 PE=1 SV=2
7	Q8IX09	2.65e-64	214	145	0.121	0.697	Q8IX09_HUMAN Erythropoietin induced cDNA-1 transcript variant 2 OS=Homo sapiens OX=9606 GN=ERIC-1s PE=1 SV=1
8	E7EVI4	5.75e-57	207	581	0.136	0.196	E7EVI4_HUMAN Transforming acidic coiled-coil containing protein 1 OS=Homo sapiens OX=9606 GN=TACC1 PE=1 SV=1
9	E7ET87	1.11e-56	207	609	0.136	0.187	E7ET87_HUMAN Transforming acidic coiled-coil containing protein 1 OS=Homo sapiens OX=9606 GN=TACC1 PE=1 SV=1
10	Q4VXL4	2.95e-56	205	575	0.171	0.249	Q4VXL4_HUMAN HCG41426, isoform CRA_c OS=Homo sapiens OX=9606 GN=TACC2 PE=1 SV=1
11	O75410	4.95e-56	209	805	0.136	0.142	TACC1_HUMAN Transforming acidic coiled-coil-containing protein 1 OS=Homo sapiens OX=9606 GN=TACC1 PE=1 SV=2
12	H0YAY0	1.07e-55	203	562	0.136	0.203	H0YAY0_HUMAN Transforming acidic coiled-coil containing protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=TACC1 PE=1 SV=1
13	Q6Y685	1.33e-55	207	774	0.128	0.138	TACC1_MOUSE Transforming acidic coiled-coil-containing protein 1 OS=Mus musculus OX=10090 GN=Tacc1 PE=1 SV=1
14	E7EMZ9	5.64e-55	209	2826	0.128	0.038	E7EMZ9_HUMAN Transforming acidic coiled-coil containing protein 2 OS=Homo sapiens OX=9606 GN=TACC2 PE=1 SV=1
15	B2RWP4	6.11e-55	209	2826	0.128	0.038	B2RWP4_HUMAN TACC2 protein OS=Homo sapiens OX=9606 GN=TACC2 PE=1 SV=1
16	O95359	6.72e-55	209	2948	0.128	0.036	TACC2_HUMAN Transforming acidic coiled-coil-containing protein 2 OS=Homo sapiens OX=9606 GN=TACC2 PE=1 SV=3
17	E9PBC6	7.84e-55	209	2875	0.128	0.037	E9PBC6_HUMAN Transforming acidic coiled-coil containing protein 2 OS=Homo sapiens OX=9606 GN=TACC2 PE=1 SV=1
18	D6RAA5	8.34e-54	204	1008	0.128	0.106	D6RAA5_HUMAN Transforming acidic coiled-coil containing protein 2 OS=Homo sapiens OX=9606 GN=TACC2 PE=1 SV=1
19	Q4VXL8	1.31e-53	204	1038	0.128	0.103	Q4VXL8_HUMAN Transforming acidic coiled-coil containing protein 2 OS=Homo sapiens OX=9606 GN=TACC2 PE=1 SV=1
20	Q9JJG0	3.24e-52	200	1149	0.132	0.097	TACC2_MOUSE Transforming acidic coiled-coil-containing protein 2 OS=Mus musculus OX=10090 GN=Tacc2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12290 DUF3802	1.8e+02	14.0	Protein of unknown function (DUF3802)
2	PF00538 Linker_histone	71	15.1	linker histone H1 and H5 family
3	PF18506 RelB_N	1.6e+02	13.5	RelB Antitoxin alpha helical domain
4	PF05010 TACC_C	3.3e-79	276.8	Transforming acidic coiled-coil-containing protein (TACC), C-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000326550

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216911	0.999	Aurora kinase A
2	9606.ENSP00000432768	0.999	Cytoskeleton-associated protein 5
3	9606.ENSP00000361540	0.975	Cell division cycle protein 20 homolog
4	9606.ENSP00000313950	0.974	Aurora kinase B
5	9606.ENSP00000378699	0.970	Cyclin-dependent kinase 1
6	9606.ENSP00000300093	0.969	Serine/threonine-protein kinase PLK1
7	9606.ENSP00000260731	0.968	Kinesin-like protein KIF11
8	9606.ENSP00000333982	0.960	Nuclear distribution protein nudE-like 1
9	9606.ENSP00000453403	0.953	Nucleolar and spindle-associated protein 1
10	9606.ENSP00000356379	0.945	Abnormal spindle-like microcephaly-associated protein
11	9606.ENSP00000296509	0.944	Mitotic spindle assembly checkpoint protein MAD2A
12	9606.ENSP00000251496	0.936	Condensin complex subunit 3
13	9606.ENSP00000362146	0.936	Borealin
14	9606.ENSP00000379975	0.932	Integrin-linked protein kinase
15	9606.ENSP00000265148	0.931	Centromere-associated protein E
16	9606.ENSP00000274026	0.931	Cyclin-A2
17	9606.ENSP00000358813	0.918	Dual specificity protein kinase TTK
18	9606.ENSP00000479606	0.914	Clathrin heavy chain 1
19	9606.ENSP00000377793	0.904	Protein regulator of cytokinesis 1
20	9606.ENSP00000247191	0.902	Disks large-associated protein 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0071840	0.988	cellular component organization or biogenesis
GO:0070507	0.985	regulation of microtubule cytoskeleton organization
GO:0033045	0.985	regulation of sister chromatid segregation
GO:0044770	0.984	cell cycle phase transition
GO:0090224	0.976	regulation of spindle organization
GO:0016043	0.973	cellular component organization
GO:0007017	0.968	microtubule-based process
GO:0044772	0.965	mitotic cell cycle phase transition
GO:0000226	0.964	microtubule cytoskeleton organization
GO:1902850	0.938	microtubule cytoskeleton organization involved in mitosis
GO:0060236	0.935	regulation of mitotic spindle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0034451	1.000	centriolar satellite
GO:0072686	0.999	mitotic spindle
GO:0005634	0.871	nucleus
GO:0070013	0.555	intracellular organelle lumen
GO:0031981	0.550	nuclear lumen
GO:0005654	0.443	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]