StarFunc result for job id Q9Y6C5

User Input

>input (1203 residues)
MTRSPPLRELPPSYTPPARTAAPQILAGSLKAPLWLRAYFQGLLFSLGCGIQRHCGKVLF
LGLLAFGALALGLRMAIIETNLEQLWVEVGSRVSQELHYTKEKLGEEAAYTSQMLIQTAR
QEGENILTPEALGLHLQAALTASKVQVSLYGKSWDLNKICYKSGVPLIENGMIERMIEKL
FPCVILTPLDCFWEGAKLQGGSAYLPGRPDIQWTNLDPEQLLEELGPFASLEGFRELLDK
AQVGQAYVGRPCLHPDDLHCPPSAPNHHSRQAPNVAHELSGGCHGFSHKFMHWQEELLLG
GMARDPQGELLRAEALQSTFLLMSPRQLYEHFRGDYQTHDIGWSEEQASTVLQAWQRRFV
QLAQEALPENASQQIHAFSSTTLDDILHAFSEVSAARVVGGYLLMLAYACVTMLRWDCAQ
SQGSVGLAGVLLVALAVASGLGLCALLGITFNAATTQVLPFLALGIGVDDVFLLAHAFTE
ALPGTPLQERMGECLQRTGTSVVLTSINNMAAFLMAALVPIPALRAFSLQAAIVVGCTFV
AVMLVFPAILSLDLRRRHCQRLDVLCCFSSPCSAQVIQILPQELGDGTVPVGIAHLTATV
QAFTHCEASSQHVVTILPPQAHLVPPPSDPLGSELFSPGGSTRDLLGQEEETRQKAACKS
LPCARWNLAHFARYQFAPLLLQSHAKAIVLVLFGALLGLSLYGATLVQDGLALTDVVPRG
TKEHAFLSAQLRYFSLYEVALVTQGGFDYAHSQRALFDLHQRFSSLKAVLPPPATQAPRT
WLHYYRNWLQGIQAAFDQDWASGRITRHSYRNGSEDGALAYKLLIQTGDAQEPLDFSQLT
TRKLVDREGLIPPELFYMGLTVWVSSDPLGLAASQANFYPPPPEWLHDKYDTTGENLRIP
PAQPLEFAQFPFLLRGLQKTADFVEAIEGARAACAEAGQAGVHAYPSGSPFLFWEQYLGL
RRCFLLAVCILLVCTFLVCALLLLNPWTAGLIVLVLAMMTVELFGIMGFLGIKLSAIPVV
ILVASVGIGVEFTVHVALGFLTTQGSRNLRAAHALEHTFAPVTDGAISTLLGLLMLAGSH
FDFIVRYFFAALTVLTLLGLLHGLVLLPVLLSILGPPPEVIQMYKESPEILSPPAPQGGG
LRWGASSSLPQSFARVTTSMTVAIHPPPLPGAYIHPAPDEPPWSPAATSSGNLSSRGPGP
ATG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1R8E2	0.843	0.689	0.000	1475	0.534	0.435	F1R8E2.pdb.gz	F1R8E2_DANRE Protein patched homolog 1 OS=Danio rerio OX=7955 GN=lep PE=3 SV=2
2	AFDB:Q13635	0.847	0.707	0.000	1447	0.536	0.446	Q13635.pdb.gz	PTC1_HUMAN Protein patched homolog 1 OS=Homo sapiens OX=9606 GN=PTCH1 PE=1 SV=2
3	AFDB:Q98864	0.849	0.838	0.000	1220	0.628	0.620	Q98864.pdb.gz	PTC1_DANRE Protein patched homolog 1 OS=Danio rerio OX=7955 GN=ptch1 PE=2 SV=1
4	AFDB:Q9Y6C5	1.000	1.000	0.000	1203	1.000	1.000	Q9Y6C5.pdb.gz	PTC2_HUMAN Protein patched homolog 2 OS=Homo sapiens OX=9606 GN=PTCH2 PE=1 SV=2
5	AFDB:P18502	0.808	0.758	1.297E-87	1286	0.352	0.330	P18502.pdb.gz	PTC_DROME Protein patched OS=Drosophila melanogaster OX=7227 GN=ptc PE=2 SV=2
6	PDB:6dmyA	0.803	0.971	1.340E-82	992	0.497	0.603	6dmyA.pdb.gz	Structural basis for the recognition of Sonic Hedgehog by human Patched1.
7	AFDB:Q09614	0.795	0.682	2.318E-76	1408	0.337	0.288	Q09614.pdb.gz	PTC1_CAEEL Protein patched homolog 1 OS=Caenorhabditis elegans OX=6239 GN=ptc-1 PE=1 SV=2
8	AFDB:F4I9G5	0.615	0.589	6.208E-45	1260	0.209	0.199	F4I9G5.pdb.gz	F4I9G5_ARATH Patched family protein OS=Arabidopsis thaliana OX=3702 GN=ATNPC1 PE=1 SV=2
9	AFDB:F4JTN1	0.620	0.577	3.453E-44	1297	0.204	0.189	F4JTN1.pdb.gz	F4JTN1_ARATH Patched family protein OS=Arabidopsis thaliana OX=3702 GN=ATNPC1-2 PE=1 SV=1
10	AFDB:Q9UHC9	0.588	0.525	8.871E-44	1359	0.206	0.182	Q9UHC9.pdb.gz	NPCL1_HUMAN NPC1-like intracellular cholesterol transporter 1 OS=Homo sapiens OX=9606 GN=NPC1L1 PE=1 SV=2
11	AFDB:O15118	0.599	0.565	1.214E-42	1278	0.200	0.188	O15118.pdb.gz	NPC1_HUMAN NPC intracellular cholesterol transporter 1 OS=Homo sapiens OX=9606 GN=NPC1 PE=1 SV=2
12	PDB:6v3fA	0.583	0.570	6.976E-37	1234	0.190	0.186	6v3fA.pdb.gz	Cryo-EM structures of NPC1L1 reveal mechanisms of cholesterol transport and ezetimibe inhibition
13	PDB:6tbuA	0.430	0.591	1.906E-16	842	0.107	0.153	6tbuA.pdb.gz	Cryo-EM structure of the Hedgehog release protein Dispatched.
14	PDB:7n6bA	0.454	0.695	4.822E-14	757	0.090	0.143	7n6bA.pdb.gz	Structures of the mycobacterial membrane protein MmpL3 reveal its mechanism of lipid transport.
15	PDB:7e2iD	0.455	0.586	7.192E-13	907	0.103	0.137	7e2iD.pdb.gz	Structural insights into proteolytic activation of the human Dispatched1 transporter for Hedgehog morphogen release.
16	PDB:7wnxA	0.426	0.675	9.564E-11	734	0.098	0.161	7wnxA.pdb.gz	Cryo-EM structure of Mycobacterium smegmatis MmpL3 complexed with ST004 in lipid nanodiscs
17	PDB:3nogA	0.327	0.381	1.469E-10	1012	0.101	0.121	3nogA.pdb.gz
18	PDB:4zivB	0.310	0.347	5.095E-10	1046	0.098	0.113	4zivB.pdb.gz
19	PDB:3w9iF	0.336	0.383	8.526E-10	1033	0.105	0.122	3w9iF.pdb.gz
20	PDB:7b5pA	0.312	0.374	9.289E-10	985	0.103	0.126	7b5pA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JVB8	0.0	1294	1382	0.533	0.464	A0A0G2JVB8_RAT Patched 1 OS=Rattus norvegicus OX=10116 GN=Ptch1 PE=3 SV=1
2	F1R8E2	0.0	1261	1475	0.532	0.434	F1R8E2_DANRE Protein patched homolog 1 OS=Danio rerio OX=7955 GN=lep PE=3 SV=2
3	O35595	0.0	2120	1182	0.894	0.909	PTC2_MOUSE Protein patched homolog 2 OS=Mus musculus OX=10090 GN=Ptch2 PE=2 SV=2
4	P18502	0.0	750	1286	0.352	0.329	PTC_DROME Protein patched OS=Drosophila melanogaster OX=7227 GN=ptc PE=2 SV=2
5	Q13635	0.0	1295	1447	0.536	0.446	PTC1_HUMAN Protein patched homolog 1 OS=Homo sapiens OX=9606 GN=PTCH1 PE=1 SV=2
6	Q61115	0.0	1291	1434	0.537	0.450	PTC1_MOUSE Protein patched homolog 1 OS=Mus musculus OX=10090 GN=Ptch1 PE=1 SV=1
7	Q6UY90	0.0	1295	1434	0.539	0.452	Q6UY90_RAT Patched OS=Rattus norvegicus OX=10116 GN=Ptch1 PE=2 SV=1
8	Q98864	0.0	1505	1220	0.634	0.625	PTC1_DANRE Protein patched homolog 1 OS=Danio rerio OX=7955 GN=ptch1 PE=2 SV=1
9	Q9Y6C5	0.0	2431	1203	1.000	1.000	PTC2_HUMAN Protein patched homolog 2 OS=Homo sapiens OX=9606 GN=PTCH2 PE=1 SV=2
10	Q09614	2.18e-171	546	1408	0.271	0.232	PTC1_CAEEL Protein patched homolog 1 OS=Caenorhabditis elegans OX=6239 GN=ptc-1 PE=1 SV=2
11	H2L0G5	5.23e-152	493	1367	0.251	0.221	PTC3_CAEEL Protein patched homolog 3 OS=Caenorhabditis elegans OX=6239 GN=ptc-3 PE=1 SV=1
12	F4I9G5	2.97e-34	145	1260	0.067	0.063	F4I9G5_ARATH Patched family protein OS=Arabidopsis thaliana OX=3702 GN=ATNPC1 PE=1 SV=2
13	F4JTN1	5.91e-34	144	1297	0.065	0.060	F4JTN1_ARATH Patched family protein OS=Arabidopsis thaliana OX=3702 GN=ATNPC1-2 PE=1 SV=1
14	Q19945	1.10e-33	143	913	0.157	0.207	Q19945_CAEEL SSD domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=daf-6 PE=4 SV=2
15	F1QNG7	4.08e-28	125	1276	0.055	0.052	F1QNG7_DANRE Niemann-Pick C1 protein isoform X2 OS=Danio rerio OX=7955 GN=im:7149020 PE=1 SV=1
16	A0A0R4IZV0	4.14e-28	125	1271	0.055	0.052	A0A0R4IZV0_DANRE Niemann-Pick C1 protein precursor OS=Danio rerio OX=7955 GN=im:7149020 PE=1 SV=2
17	A0A2R8Q2J0	4.72e-28	125	1277	0.055	0.052	A0A2R8Q2J0_DANRE Niemann-Pick C1 protein isoform X1 OS=Danio rerio OX=7955 GN=im:7149020 PE=1 SV=1
18	B4DIP7	9.32e-27	120	776	0.057	0.089	B4DIP7_HUMAN cDNA FLJ57114, highly similar to Niemann-Pick C1 protein OS=Homo sapiens OX=9606 PE=2 SV=1
19	O15118	2.35e-26	120	1278	0.057	0.054	NPC1_HUMAN NPC intracellular cholesterol transporter 1 OS=Homo sapiens OX=9606 GN=NPC1 PE=1 SV=2
20	Q59GR1	2.44e-26	119	1289	0.057	0.054	Q59GR1_HUMAN Niemann-Pick disease, type C1 variant (Fragment) OS=Homo sapiens OX=9606 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03176 MMPL	4.8e+02	11.1	MMPL family
2	PF02460 Patched	2.7e-69	245.9	Patched family
3	PF12349 Sterol-sensing	1e-40	150.5	Sterol-sensing domain of SREBP cleavage-activation

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361266

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000297261	0.998	Sonic hedgehog protein
2	9606.ENSP00000295731	0.996	Indian hedgehog protein
3	9606.ENSP00000266991	0.995	Desert hedgehog protein
4	9606.ENSP00000249373	0.992	Smoothened homolog
5	9606.ENSP00000228682	0.963	Zinc finger protein GLI1
6	9606.ENSP00000376458	0.924	Cell adhesion molecule-related/down-regulated by oncogenes
7	9606.ENSP00000390436	0.914	Zinc finger protein GLI2
8	9606.ENSP00000379258	0.910	Transcriptional activator GLI3
9	9606.ENSP00000332353	0.906	Protein patched homolog 1
10	9606.ENSP00000298743	0.903	Growth arrest-specific protein 1
11	9606.ENSP00000358918	0.901	Suppressor of fused homolog
12	9606.ENSP00000418663	0.897	Brother of CDO
13	9606.ENSP00000354621	0.861	E3 ubiquitin-protein ligase SMURF1
14	9606.ENSP00000262435	0.856	E3 ubiquitin-protein ligase SMURF2
15	9606.ENSP00000263816	0.839	Low-density lipoprotein receptor-related protein 2
16	9606.ENSP00000296575	0.768	Hedgehog-interacting protein
17	9606.ENSP00000463027	0.719	Nuclear receptor coactivator 4
18	9606.ENSP00000401303	0.708	SHC-transforming protein 1
19	9606.ENSP00000375978	0.674	X-ray repair cross-complementing protein 5
20	9606.ENSP00000372023	0.661	Serine/threonine-protein kinase Chk2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004888	1.000	transmembrane signaling receptor activity
GO:0001664	1.000	G protein-coupled receptor binding
GO:0097108	0.987	hedgehog family protein binding
GO:0008289	0.968	lipid binding
GO:0005119	0.947	smoothened binding
GO:0008158	0.894	hedgehog receptor activity
GO:0097159	0.629	organic cyclic compound binding
GO:0005496	0.406	steroid binding
GO:0032934	0.403	sterol binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.986	regulation of cellular process
GO:0009987	0.967	cellular process
GO:0048519	0.883	negative regulation of biological process
GO:0048523	0.862	negative regulation of cellular process
GO:0009966	0.847	regulation of signal transduction
GO:0032502	0.784	developmental process
GO:0032501	0.750	multicellular organismal process
GO:0048856	0.736	anatomical structure development
GO:0048518	0.689	positive regulation of biological process
GO:0048585	0.647	negative regulation of response to stimulus
GO:0050896	0.549	response to stimulus
GO:0048522	0.522	positive regulation of cellular process
GO:0007275	0.465	multicellular organism development
GO:0048731	0.426	system development
GO:0019222	0.411	regulation of metabolic process
GO:0051716	0.398	cellular response to stimulus
GO:0048513	0.392	animal organ development
GO:0060255	0.391	regulation of macromolecule metabolic process
GO:0009968	0.384	negative regulation of signal transduction
GO:0080090	0.362	regulation of primary metabolic process
GO:0048869	0.361	cellular developmental process
GO:0051171	0.351	regulation of nitrogen compound metabolic process
GO:0050793	0.343	regulation of developmental process
GO:0007165	0.339	signal transduction
GO:0030154	0.337	cell differentiation
GO:0031323	0.331	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0016020	0.989	membrane
GO:0043226	0.977	organelle
GO:0071944	0.972	cell periphery
GO:0120025	0.970	plasma membrane bounded cell projection
GO:0043227	0.965	membrane-bounded organelle
GO:0005886	0.942	plasma membrane
GO:0043231	0.902	intracellular membrane-bounded organelle
GO:0005737	0.857	cytoplasm
GO:0005634	0.697	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]