StarFunc result for job id Q9Y6D5

User Input

>input (1785 residues)
MQESQTKSMFVSRALEKILADKEVKRPQHSQLRRACQVALDEIKAEIEKQRLGTAAPPKA
NFIEADKYFLPFELACQSKSPRVVSTSLDCLQKLIAYGHITGNAPDSGAPGKRLIDRIVE
TICSCFQGPQTDEGVQLQIIKALLTAVTSPHIEIHEGTILQTVRTCYNIYLASKNLINQT
TAKATLTQMLNVIFTRMENQVLQEARELEKPIQSKPQSPVIQAAAVSPKFVRLKHSQAQS
KPTTPEKTDLTNGEHARSDSGKVSTENGDAPRERGSSLSGTDDGAQEVVKDILEDVVTSA
IKEAAEKHGLTEPERVLGELECQECAIPPGVDENSQTNGIADDRQSLSSADNLESDAQGH
QVAARFSHVLQKDAFLVFRSLCKLSMKPLGEGPPDPKSHELRSKVVSLQLLLSVLQNAGP
VFRTHEMFINAIKQYLCVALSKNGVSSVPDVFELSLAIFLTLLSNFKMHLKMQIEVFFKE
IFLNILETSTSSFEHRWMVIQTLTRICADAQCVVDIYVNYDCDLNAANIFERLVNDLSKI
AQGRSGHELGMTPLQELSLRKKGLECLVSILKCMVEWSKDLYVNPNHQTSLGQERLTDQE
IGDGKGLDMARRCSVTSMESTVSSGTQTTVQDDPEQFEVIKQQKEIIEHGIELFNKKPKR
GIQFLQEQGMLGTSVEDIAQFLHQEERLDSTQVGDFLGDSARFNKEVMYAYVDQLDFCEK
EFVSALRTFLEGFRLPGEAQKIDRLMEKFAARYIECNQGQTLFASADTAYVLAYSIIMLT
TDLHSPQVKNKMTKEQYIKMNRGINDSKDLPEEYLSSIYEEIEGKKIAMKETKELTIATK
STKQNVASEKQRRLLYNLEMEQMAKTAKALMEAVSHAKAPFTSATHLDHVRPMFKLVWTP
LLAAYSIGLQNCDDTEVASLCLEGIRCAIRIACIFGMQLERDAYVQALARFSLLTASSSI
TEMKQKNIDTIKTLITVAHTDGNYLGNSWHEILKCISQLELAQLIGTGVKTRYLSGSGRE
REGSLKGHTLAGEEFMGLGLGNLVSGGVDKRQMASFQESVGETSSQSVVVAVDRIFTGST
RLDGNAIVDFVRWLCAVSMDELASPHHPRMFSLQKIVEISYYNMNRIRLQWSRIWHVIGD
HFNKVGCNPNEDVAIFAVDSLRQLSMKFLEKGELANFRFQKDFLRPFEHIMKKNRSPTIR
DMAIRCIAQMVNSQAANIRSGWKNIFAVFHQAASDHDGNIVELAFQTTCHIVTTIFQHHF
PAAIDSFQDAVKCLSEFACNAAFPDTSMEAIRLIRFCGKYVSERPRVLQEYTSDDMNVAP
GDRVWVRGWFPILFELSCIINRCKLDVRTRGLTVMFEIMKSYGHTFEKHWWQDLFRIVFR
IFDNMKLPEQLSEKSEWMTTTCNHALYAICDVFTQFYEALNEVLLSDVFAQLQWCVKQDN
EQLARSGTNCLENLVISNGEKFSPEVWDETCNCMLDIFKTTIPHVLLTWRPVGMEEDSSE
KHLDVDLDRQSLSSIDKNPSERGQSQLSNPTDDSWKGRPYANQKLFASLLIKCVVQLELI
QTIDNIVFYPATSKKEDAEHMVAAQQDTLDADIHIETEDQGMYKYMSSQHLFKLLDCLQE
SHSFSKAFNSNYEQRTVLWRAGFKGKSKPNLLKQETSSLACCLRILFRMYVDENRRDSWE
EIQQRLLTVCSEALAYFITVNSESHREAWTSLLLLLLTKTLKINDEKFKAHASMYYPYLC
EIMQFDLIPELRAVLRKFFLRIGVVYKIWIPEEPSQVPAALSPVW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E7FCG1	0.887	0.858	0.000	1846	0.798	0.771	E7FCG1.pdb.gz	E7FCG1_DANRE ADP-ribosylation factor guanine nucleotide-exchange factor 2 (brefeldin A-inhibited) OS=Danio rerio OX=7955 GN=arfgef2 PE=1 SV=1
2	AFDB:Q7TSU1	0.892	0.890	0.000	1791	0.953	0.950	Q7TSU1.pdb.gz	BIG2_RAT Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Rattus norvegicus OX=10116 GN=Arfgef2 PE=1 SV=1
3	AFDB:Q9VJW1	0.786	0.845	0.000	1653	0.593	0.640	Q9VJW1.pdb.gz	Q9VJW1_DROME LD29171p OS=Drosophila melanogaster OX=7227 GN=Sec71 PE=1 SV=2
4	AFDB:Q9Y6D6	0.862	0.833	0.000	1849	0.768	0.741	Q9Y6D6.pdb.gz	BIG1_HUMAN Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Homo sapiens OX=9606 GN=ARFGEF1 PE=1 SV=2
5	AFDB:F4JN05	0.740	0.773	1.026E-75	1706	0.300	0.314	F4JN05.pdb.gz	BIG4_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 4 OS=Arabidopsis thaliana OX=3702 GN=BIG4 PE=3 SV=1
6	AFDB:Q9UT02	0.721	0.711	3.024E-75	1811	0.300	0.295	Q9UT02.pdb.gz	SEC7A_SCHPO Protein transport protein sec71 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec71 PE=1 SV=1
7	AFDB:F4JSZ5	0.735	0.775	6.746E-75	1687	0.303	0.321	F4JSZ5.pdb.gz	BIG1_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Arabidopsis thaliana OX=3702 GN=BIG1 PE=2 SV=1
8	AFDB:Q42510	0.502	0.600	1.258E-41	1451	0.169	0.208	Q42510.pdb.gz	GNOM_ARATH ARF guanine-nucleotide exchange factor GNOM OS=Arabidopsis thaliana OX=3702 GN=GN PE=1 SV=1
9	AFDB:Q7Z3U7	0.436	0.451	1.212E-26	1717	0.148	0.154	Q7Z3U7.pdb.gz	MON2_HUMAN Protein MON2 homolog OS=Homo sapiens OX=9606 GN=MON2 PE=1 SV=3
10	PDB:6u3eA	0.105	0.457	1.856E-11	397	0.054	0.242	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
11	PDB:6bbpA	0.105	0.353	2.288E-11	520	0.053	0.183	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
12	AFDB:E7F2Q0	0.105	0.459	6.232E-11	396	0.053	0.240	E7F2Q0.pdb.gz	E7F2Q0_DANRE Cytohesin 3a OS=Danio rerio OX=7955 GN=cyth3a PE=4 SV=1
13	PDB:7mqaSP	0.124	0.095	1.505E-8	2485	0.119	0.086	7mqaSP.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:7ajuUT	0.116	0.097	2.133E-8	2313	0.114	0.088	7ajuUT.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
15	PDB:7mq8LM	0.149	0.136	3.357E-8	2005	0.113	0.101	7mq8LM.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:7sukSP	0.121	0.107	6.513E-8	2234	0.114	0.091	7sukSP.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
17	PDB:7mqaLM	0.132	0.121	6.744E-8	2041	0.134	0.118	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:7mq8SP	0.134	0.124	1.099E-7	1993	0.117	0.104	7mq8SP.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:7su3A	0.132	0.072	2.629E-7	3802	0.102	0.048	7su3A.pdb.gz	Autophosphorylation transforms DNA-PK from protecting to processing DNA ends.
20	PDB:7k1nA	0.096	0.070	4.137E-7	3634	0.121	0.059	7k1nA.pdb.gz	Structure of an activated DNA-PK and its implications for NHEJ.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4A631	0.0	2749	1846	0.774	0.749	BIG1_RAT Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Rattus norvegicus OX=10116 GN=Arfgef1 PE=1 SV=1
2	E7FCG1	0.0	2832	1846	0.794	0.768	E7FCG1_DANRE ADP-ribosylation factor guanine nucleotide-exchange factor 2 (brefeldin A-inhibited) OS=Danio rerio OX=7955 GN=arfgef2 PE=1 SV=1
3	F4IXW2	0.0	728	1739	0.308	0.316	BIG5_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 5 OS=Arabidopsis thaliana OX=3702 GN=BIG5 PE=1 SV=2
4	F4JN05	0.0	716	1706	0.234	0.245	BIG4_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 4 OS=Arabidopsis thaliana OX=3702 GN=BIG4 PE=3 SV=1
5	F4JSZ5	0.0	726	1687	0.239	0.253	BIG1_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Arabidopsis thaliana OX=3702 GN=BIG1 PE=2 SV=1
6	P11075	0.0	703	2009	0.273	0.243	SEC7_YEAST Protein transport protein SEC7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC7 PE=1 SV=2
7	Q7TSU1	0.0	3514	1791	0.954	0.950	BIG2_RAT Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Rattus norvegicus OX=10116 GN=Arfgef2 PE=1 SV=1
8	Q9LPC5	0.0	884	1750	0.329	0.335	BIG3_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 3 OS=Arabidopsis thaliana OX=3702 GN=BIG3 PE=1 SV=1
9	Q9LZX8	0.0	759	1793	0.281	0.280	BIG2_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Arabidopsis thaliana OX=3702 GN=BIG2 PE=2 SV=1
10	Q9P7V5	0.0	729	1822	0.271	0.265	SEC7B_SCHPO Protein transport protein sec72 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec72 PE=1 SV=1
11	Q9UT02	0.0	684	1811	0.261	0.257	SEC7A_SCHPO Protein transport protein sec71 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec71 PE=1 SV=1
12	Q9VJW1	0.0	2089	1653	0.599	0.647	Q9VJW1_DROME LD29171p OS=Drosophila melanogaster OX=7227 GN=Sec71 PE=1 SV=2
13	Q9Y6D5	0.0	3729	1785	1.000	1.000	BIG2_HUMAN Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Homo sapiens OX=9606 GN=ARFGEF2 PE=1 SV=3
14	Q9Y6D6	0.0	2747	1849	0.775	0.748	BIG1_HUMAN Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Homo sapiens OX=9606 GN=ARFGEF1 PE=1 SV=2
15	Q9FLY5	1.61e-67	254	1443	0.137	0.170	GNL1_ARATH ARF guanine-nucleotide exchange factor GNL1 OS=Arabidopsis thaliana OX=3702 GN=GNL1 PE=3 SV=1
16	Q42510	2.27e-67	254	1451	0.145	0.178	GNOM_ARATH ARF guanine-nucleotide exchange factor GNOM OS=Arabidopsis thaliana OX=3702 GN=GN PE=1 SV=1
17	Q92538	1.93e-62	239	1859	0.163	0.157	GBF1_HUMAN Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=GBF1 PE=1 SV=2
18	A0A669KB10	8.02e-61	234	1884	0.120	0.114	A0A669KB10_HUMAN Golgi brefeldin A resistant guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=GBF1 PE=1 SV=1
19	A0A669KBG8	9.39e-61	233	1892	0.120	0.113	A0A669KBG8_HUMAN Golgi brefeldin A resistant guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=GBF1 PE=1 SV=1
20	Q6DFZ1	1.19e-55	217	1861	0.120	0.115	Q6DFZ1_MOUSE Golgi-specific brefeldin A-resistance factor 1 OS=Mus musculus OX=10090 GN=Gbf1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20252 BIG2_C	5.1e-58	207.6	BIG2 C-terminal domain
2	PF16213 DCB	1.4e-38	143.8	Dimerisation and cyclophilin-binding domain of Mon2
3	PF07560 DUF1539	12	17.4	Domain of Unknown Function (DUF1539)
4	PF09324 DUF1981	2.1e-28	109.4	Domain of unknown function (DUF1981)
5	PF02985 HEAT	31	16.2	HEAT repeat
6	PF20412 RALGAPB_N	7e+02	11.6	RALGAPB N-terminal domain
7	PF01369 Sec7	6.3e-68	239.6	Sec7 domain
8	PF12783 Sec7_N	1.2e-46	169.9	Guanine nucleotide exchange factor in Golgi transport N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360985

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000440005	0.967	ADP-ribosylation factor 1
2	9606.ENSP00000400175	0.927	Transforming protein RhoA
3	9606.ENSP00000400717	0.906	Guanine nucleotide-binding protein subunit alpha-13
4	9606.ENSP00000275364	0.905	Guanine nucleotide-binding protein subunit alpha-12
5	9606.ENSP00000481878	0.902	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
6	9606.ENSP00000248572	0.900	Guanine nucleotide-binding protein G(T) subunit gamma-T1
7	9606.ENSP00000358866	0.792	Filamin-A
8	9606.ENSP00000355735	0.779	Endoplasmic reticulum membrane-associated RNA degradation protein
9	9606.ENSP00000262215	0.752	Brefeldin A-inhibited guanine nucleotide-exchange protein 1
10	9606.ENSP00000359000	0.735	Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1
11	9606.ENSP00000249923	0.722	Coatomer subunit beta
12	9606.ENSP00000341779	0.706	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
13	9606.ENSP00000298316	0.696	ADP-ribosylation factor 6
14	9606.ENSP00000306010	0.683	ADP-ribosylation factor 4
15	9606.ENSP00000258091	0.669	T-complex protein 1 subunit eta
16	9606.ENSP00000282516	0.664	Nipped-B-like protein
17	9606.ENSP00000308515	0.645	dephospho-CoA kinase domain containing
18	9606.ENSP00000332247	0.636	V-type proton ATPase 116 kDa subunit a isoform 2
19	9606.ENSP00000438507	0.634	Uncharacterized protein
20	9606.ENSP00000261636	0.626	ADP-ribosylation factor-like protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0005085	0.999	guanyl-nucleotide exchange factor activity
GO:0051018	0.987	protein kinase A binding
GO:0008092	0.963	cytoskeletal protein binding
GO:0034237	0.910	protein kinase A regulatory subunit binding
GO:0017022	0.886	myosin binding
GO:0050811	0.482	GABA receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0006810	0.987	transport
GO:0065007	0.968	biological regulation
GO:0050789	0.948	regulation of biological process
GO:0016192	0.913	vesicle-mediated transport
GO:0050794	0.897	regulation of cellular process
GO:0046903	0.892	secretion
GO:0140352	0.890	export from cell
GO:0006887	0.759	exocytosis
GO:0071840	0.582	cellular component organization or biogenesis
GO:0048518	0.572	positive regulation of biological process
GO:0016043	0.534	cellular component organization
GO:0051641	0.442	cellular localization
GO:0008152	0.407	metabolic process
GO:0050896	0.402	response to stimulus
GO:0048522	0.396	positive regulation of cellular process
GO:0006996	0.377	organelle organization
GO:0071704	0.358	organic substance metabolic process
GO:0019222	0.339	regulation of metabolic process
GO:0044237	0.318	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	0.999	Golgi apparatus
GO:0005829	0.955	cytosol
GO:0043228	0.941	non-membrane-bounded organelle
GO:0043232	0.932	intracellular non-membrane-bounded organelle
GO:0016020	0.895	membrane
GO:0098791	0.698	Golgi apparatus subcompartment
GO:0031982	0.690	vesicle
GO:0005802	0.671	trans-Golgi network
GO:0015630	0.530	microtubule cytoskeleton
GO:0031090	0.529	organelle membrane
GO:0098588	0.428	bounding membrane of organelle
GO:0031410	0.375	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]