StarFunc result for job id Q9Y6D6

User Input

>input (1849 residues)
MYEGKKTKNMFLTRALEKILADKEVKKAHHSQLRKACEVALEEIKAETEKQSPPHGEAKA
GSSTLPPVKSKTNFIEADKYFLPFELACQSKCPRIVSTSLDCLQKLIAYGHLTGNAPDST
TPGKKLIDRIIETICGCFQGPQTDEGVQLQIIKALLTAVTSQHIEIHEGTVLQAVRTCYN
IYLASKNLINQTTAKATLTQMLNVIFARMENQALQEAKQMEKERHRQHHHLLQSPVSHHE
PESPQLRYLPPQTVDHISQEHEGDLDLHTNDVDKSLQDDTEPENGSDISSAENEQTEADQ
ATAAETLSKNEVLYDGENHDCEEKPQDIVQNIVEEMVNIVVGDMGEGTTINASADGNIGT
IEDGSDSENIQANGIPGTPISVAYTPSLPDDRLSVSSNDTQESGNSSGPSPGAKFSHILQ
KDAFLVFRSLCKLSMKPLSDGPPDPKSHELRSKILSLQLLLSILQNAGPIFRTNEMFINA
IKQYLCVALSKNGVSSVPEVFELSLSIFLTLLSNFKTHLKMQIEVFFKEIFLYILETSTS
SFDHKWMVIQTLTRICADAQSVVDIYVNYDCDLNAANIFERLVNDLSKIAQGRGSQELGM
SNVQELSLRKKGLECLVSILKCMVEWSKDQYVNPNSQTTLGQEKPSEQEMSEIKHPETIN
RYGSLNSLESTSSSGIGSYSTQMSGTDNPEQFEVLKQQKEIIEQGIDLFNKKPKRGIQYL
QEQGMLGTTPEDIAQFLHQEERLDSTQVGEFLGDNDKFNKEVMYAYVDQHDFSGKDFVSA
LRMFLEGFRLPGEAQKIDRLMEKFAARYLECNQGQTLFASADTAYVLAYSIIMLTTDLHS
PQVKNKMTKEQYIKMNRGINDSKDLPEEYLSAIYNEIAGKKISMKETKELTIPTKSSKQN
VASEKQRRLLYNLEMEQMAKTAKALMEAVSHVQAPFTSATHLEHVRPMFKLAWTPFLAAF
SVGLQDCDDTEVASLCLEGIRCAIRIACIFSIQLERDAYVQALARFTLLTVSSGITEMKQ
KNIDTIKTLITVAHTDGNYLGNSWHEILKCISQLELAQLIGTGVKPRYISGTVRGREGSL
TGTKDQAPDEFVGLGLVGGNVDWKQIASIQESIGETSSQSVVVAVDRIFTGSTRLDGNAI
VDFVRWLCAVSMDELLSTTHPRMFSLQKIVEISYYNMGRIRLQWSRIWEVIGDHFNKVGC
NPNEDVAIFAVDSLRQLSMKFLEKGELANFRFQKDFLRPFEHIMKRNRSPTIRDMVVRCI
AQMVNSQAANIRSGWKNIFSVFHLAASDQDESIVELAFQTTGHIVTLVFEKHFPATIDSF
QDAVKCLSEFACNAAFPDTSMEAIRLIRHCAKYVSDRPQAFKEYTSDDMNVAPEDRVWVR
GWFPILFELSCIINRCKLDVRTRGLTVMFEIMKTYGHTYEKHWWQDLFRIVFRIFDNMKL
PEQQTEKAEWMTTTCNHALYAICDVFTQYLEVLSDVLLDDIFAQLYWCVQQDNEQLARSG
TNCLENVVILNGEKFTLEIWDKTCNCTLDIFKTTIPHALLTWRPNSGETAPPPPSPVSEK
PLDTISQKSVDIHDSIQPRSVDNRPQAPLVSASAVNEEVSKIKSTAKFPEQKLFAALLIK
CVVQLELIQTIDNIVFFPATSKKEDAENLAAAQRDAVDFDVRVDTQDQGMYRFLTSQQLF
KLLDCLLESHRFAKAFNSNNEQRTALWKAGFKGKSKPNLLKQETSSLACGLRILFRMYMD
ESRVSAWEEVQQRLLNVCSEALSYFLTLTSESHREAWTNLLLLFLTKVLKISDNRFKAHA
SFYYPLLCEIMQFDLIPELRAVLRRFFLRIGVVFQISQPPEQELGINKQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E7FCG1	0.846	0.848	0.000	1846	0.734	0.736	E7FCG1.pdb.gz	E7FCG1_DANRE ADP-ribosylation factor guanine nucleotide-exchange factor 2 (brefeldin A-inhibited) OS=Danio rerio OX=7955 GN=arfgef2 PE=1 SV=1
2	AFDB:Q7TSU1	0.798	0.822	0.000	1791	0.736	0.760	Q7TSU1.pdb.gz	BIG2_RAT Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Rattus norvegicus OX=10116 GN=Arfgef2 PE=1 SV=1
3	AFDB:Q9VJW1	0.736	0.817	0.000	1653	0.591	0.661	Q9VJW1.pdb.gz	Q9VJW1_DROME LD29171p OS=Drosophila melanogaster OX=7227 GN=Sec71 PE=1 SV=2
4	AFDB:Q9Y6D6	1.000	1.000	0.000	1849	1.000	1.000	Q9Y6D6.pdb.gz	BIG1_HUMAN Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Homo sapiens OX=9606 GN=ARFGEF1 PE=1 SV=2
5	AFDB:Q9FLY5	0.448	0.555	1.945E-41	1443	0.170	0.218	Q9FLY5.pdb.gz	GNL1_ARATH ARF guanine-nucleotide exchange factor GNL1 OS=Arabidopsis thaliana OX=3702 GN=GNL1 PE=3 SV=1
6	AFDB:Q42510	0.483	0.598	4.354E-40	1451	0.168	0.214	Q42510.pdb.gz	GNOM_ARATH ARF guanine-nucleotide exchange factor GNOM OS=Arabidopsis thaliana OX=3702 GN=GN PE=1 SV=1
7	AFDB:Q7Z3U7	0.402	0.428	2.695E-26	1717	0.153	0.164	Q7Z3U7.pdb.gz	MON2_HUMAN Protein MON2 homolog OS=Homo sapiens OX=9606 GN=MON2 PE=1 SV=3
8	PDB:6bbpA	0.102	0.353	2.088E-11	520	0.052	0.185	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
9	AFDB:E7F2Q0	0.102	0.463	2.123E-11	396	0.052	0.242	E7F2Q0.pdb.gz	E7F2Q0_DANRE Cytohesin 3a OS=Danio rerio OX=7955 GN=cyth3a PE=4 SV=1
10	AFDB:F1R9I9	0.106	0.477	3.131E-11	399	0.052	0.241	F1R9I9.pdb.gz
11	PDB:6u3eA	0.102	0.462	4.233E-11	397	0.051	0.237	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
12	AFDB:Q54KA7	0.108	0.201	2.898E-10	986	0.064	0.121	Q54KA7.pdb.gz	SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum OX=44689 GN=secG PE=2 SV=1
13	PDB:7mqaSP	0.111	0.095	1.716E-8	2485	0.120	0.089	7mqaSP.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:7mq8LM	0.114	0.108	2.122E-8	2005	0.101	0.093	7mq8LM.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:7ajuUT	0.088	0.077	3.868E-8	2313	0.109	0.087	7ajuUT.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
16	PDB:7mqaLM	0.083	0.078	7.567E-8	2041	0.108	0.098	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:7sukSP	0.095	0.085	2.343E-7	2234	0.111	0.092	7sukSP.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
18	PDB:7su3A	0.126	0.071	2.796E-7	3802	0.097	0.047	7su3A.pdb.gz	Autophosphorylation transforms DNA-PK from protecting to processing DNA ends.
19	PDB:7r5jB0	0.127	0.130	3.221E-7	1748	0.083	0.088	7r5jB0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
20	PDB:7jq9A	0.114	0.096	3.709E-7	2427	0.093	0.071	7jq9A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4A631	0.0	3748	1846	0.970	0.971	BIG1_RAT Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Rattus norvegicus OX=10116 GN=Arfgef1 PE=1 SV=1
2	E7FCG1	0.0	2686	1846	0.736	0.737	E7FCG1_DANRE ADP-ribosylation factor guanine nucleotide-exchange factor 2 (brefeldin A-inhibited) OS=Danio rerio OX=7955 GN=arfgef2 PE=1 SV=1
3	F4IXW2	0.0	634	1739	0.216	0.230	BIG5_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 5 OS=Arabidopsis thaliana OX=3702 GN=BIG5 PE=1 SV=2
4	F4JN05	0.0	716	1706	0.229	0.248	BIG4_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 4 OS=Arabidopsis thaliana OX=3702 GN=BIG4 PE=3 SV=1
5	F4JSZ5	0.0	708	1687	0.234	0.256	BIG1_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Arabidopsis thaliana OX=3702 GN=BIG1 PE=2 SV=1
6	P11075	0.0	652	2009	0.220	0.203	SEC7_YEAST Protein transport protein SEC7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC7 PE=1 SV=2
7	Q7TSU1	0.0	2712	1791	0.739	0.763	BIG2_RAT Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Rattus norvegicus OX=10116 GN=Arfgef2 PE=1 SV=1
8	Q9LPC5	0.0	763	1750	0.237	0.251	BIG3_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 3 OS=Arabidopsis thaliana OX=3702 GN=BIG3 PE=1 SV=1
9	Q9LZX8	0.0	736	1793	0.269	0.278	BIG2_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Arabidopsis thaliana OX=3702 GN=BIG2 PE=2 SV=1
10	Q9P7V5	0.0	745	1822	0.259	0.262	SEC7B_SCHPO Protein transport protein sec72 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec72 PE=1 SV=1
11	Q9UT02	0.0	679	1811	0.259	0.264	SEC7A_SCHPO Protein transport protein sec71 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec71 PE=1 SV=1
12	Q9VJW1	0.0	1868	1653	0.514	0.575	Q9VJW1_DROME LD29171p OS=Drosophila melanogaster OX=7227 GN=Sec71 PE=1 SV=2
13	Q9Y6D5	0.0	2735	1785	0.748	0.775	BIG2_HUMAN Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Homo sapiens OX=9606 GN=ARFGEF2 PE=1 SV=3
14	Q9Y6D6	0.0	3859	1849	1.000	1.000	BIG1_HUMAN Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Homo sapiens OX=9606 GN=ARFGEF1 PE=1 SV=2
15	Q9FLY5	4.82e-70	263	1443	0.135	0.173	GNL1_ARATH ARF guanine-nucleotide exchange factor GNL1 OS=Arabidopsis thaliana OX=3702 GN=GNL1 PE=3 SV=1
16	Q42510	4.20e-68	256	1451	0.136	0.174	GNOM_ARATH ARF guanine-nucleotide exchange factor GNOM OS=Arabidopsis thaliana OX=3702 GN=GN PE=1 SV=1
17	A0A669KB10	7.74e-57	221	1884	0.115	0.113	A0A669KB10_HUMAN Golgi brefeldin A resistant guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=GBF1 PE=1 SV=1
18	A0A669KBG8	8.53e-57	221	1892	0.115	0.112	A0A669KBG8_HUMAN Golgi brefeldin A resistant guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=GBF1 PE=1 SV=1
19	Q92538	1.23e-56	220	1859	0.115	0.114	GBF1_HUMAN Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=GBF1 PE=1 SV=2
20	X1WHH8	3.16e-56	202	351	0.053	0.279	X1WHH8_DANRE Cytohesin 1a OS=Danio rerio OX=7955 GN=cyth3b PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20252 BIG2_C	4.4e-56	201.3	BIG2 C-terminal domain
2	PF16213 DCB	5.1e-43	158.3	Dimerisation and cyclophilin-binding domain of Mon2
3	PF09324 DUF1981	3.2e-30	115.2	Domain of unknown function (DUF1981)
4	PF01369 Sec7	4.3e-71	249.9	Sec7 domain
5	PF12783 Sec7_N	2.7e-45	165.6	Guanine nucleotide exchange factor in Golgi transport N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262215

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000440005	0.960	ADP-ribosylation factor 1
2	9606.ENSP00000400175	0.946	Transforming protein RhoA
3	9606.ENSP00000261636	0.922	ADP-ribosylation factor-like protein 1
4	9606.ENSP00000400717	0.911	Guanine nucleotide-binding protein subunit alpha-13
5	9606.ENSP00000275364	0.905	Guanine nucleotide-binding protein subunit alpha-12
6	9606.ENSP00000481878	0.902	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
7	9606.ENSP00000248572	0.900	Guanine nucleotide-binding protein G(T) subunit gamma-T1
8	9606.ENSP00000471457	0.860	Unconventional myosin-IXb
9	9606.ENSP00000318195	0.840	Nucleolin
10	9606.ENSP00000471191	0.812	Nuclear pore glycoprotein p62
11	9606.ENSP00000249923	0.766	Coatomer subunit beta
12	9606.ENSP00000360985	0.752	Brefeldin A-inhibited guanine nucleotide-exchange protein 2
13	9606.ENSP00000359000	0.737	Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1
14	9606.ENSP00000298316	0.710	ADP-ribosylation factor 6
15	9606.ENSP00000221801	0.704	rRNA 2'-O-methyltransferase fibrillarin
16	9606.ENSP00000362590	0.693	TBC1 domain family member 22B
17	9606.ENSP00000282516	0.679	Nipped-B-like protein
18	9606.ENSP00000381007	0.678	Neuron navigator 3
19	9606.ENSP00000354878	0.667	Kinesin-like protein KIF21A
20	9606.ENSP00000436152	0.666	Tumor protein p53 inducible protein 11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005085	1.000	guanyl-nucleotide exchange factor activity
GO:0034237	0.999	protein kinase A regulatory subunit binding
GO:0017022	0.999	myosin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0065007	0.997	biological regulation
GO:0050789	0.990	regulation of biological process
GO:0006810	0.987	transport
GO:0050794	0.984	regulation of cellular process
GO:0071840	0.975	cellular component organization or biogenesis
GO:0016192	0.947	vesicle-mediated transport
GO:0016043	0.934	cellular component organization
GO:0048518	0.877	positive regulation of biological process
GO:0048583	0.809	regulation of response to stimulus
GO:0009966	0.690	regulation of signal transduction
GO:0048522	0.646	positive regulation of cellular process
GO:0051641	0.448	cellular localization
GO:0006996	0.434	organelle organization
GO:0008152	0.417	metabolic process
GO:0019222	0.379	regulation of metabolic process
GO:0044237	0.374	cellular metabolic process
GO:0071704	0.370	organic substance metabolic process
GO:0060255	0.359	regulation of macromolecule metabolic process
GO:0050896	0.356	response to stimulus
GO:0044238	0.356	primary metabolic process
GO:0032501	0.323	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	0.999	Golgi apparatus
GO:0070013	0.995	intracellular organelle lumen
GO:0005654	0.989	nucleoplasm
GO:0005829	0.934	cytosol
GO:0016020	0.904	membrane
GO:0043232	0.780	intracellular non-membrane-bounded organelle
GO:0098791	0.642	Golgi apparatus subcompartment
GO:0005802	0.633	trans-Golgi network
GO:0031090	0.472	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]