StarFunc result for job id Q9Y6D9

User Input

>input (718 residues)
MEDLGENTMVLSTLRSLNNFISQRVEGGSGLDISTSAPGSLQMQYQQSMQLEERAEQIRS
KSHLIQVEREKMQMELSHKRARVELERAASTSARNYEREVDRNQELLTRIRQLQEREAGA
EEKMQEQLERNRQCQQNLDAASKRLREKEDSLAQAGETINALKGRISELQWSVMDQEMRV
KRLESEKQELQEQLDLQHKKCQEANQKIQELQASQEARADHEQQIKDLEQKLSLQEQDAA
IVKNMKSELVRLPRLERELKQLREESAHLREMRETNGLLQEELEGLQRKLGRQEKMQETL
VGLELENERLLAKLQSWERLDQTMGLSIRTPEDLSRFVVELQQRELALKDKNSAVTSSAR
GLEKARQQLQEELRQVSGQLLEERKKRETHEALARRLQKRVLLLTKERDGMRAILGSYDS
ELTPAEYSPQLTRRMREAEDMVQKVHSHSAEMEAQLSQALEELGGQKQRADMLEMELKML
KSQSSSAEQSFLFSREEADTLRLKVEELEGERSRLEEEKRMLEAQLERRALQGDYDQSRT
KVLHMSLNPTSVARQRLREDHSQLQAECERLRGLLRAMERGGTVPADLEAAAASLPSSKE
VAELKKQVESAELKNQRLKEVFQTKIQEFRKACYTLTGYQIDITTENQYRLTSLYAEHPG
DCLIFKATSPSGSKMQLLETEFSHTVGELIEVHLRRQDSIPAFLSSLTLELFSRQTVA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y6D9	1.000	1.000	4.143E-88	718	1.000	1.000	Q9Y6D9.pdb.gz	MD1L1_HUMAN Mitotic spindle assembly checkpoint protein MAD1 OS=Homo sapiens OX=9606 GN=MAD1L1 PE=1 SV=2
2	AFDB:Q9WTX8	0.342	0.343	6.517E-71	717	0.811	0.812	Q9WTX8.pdb.gz	MD1L1_MOUSE Mitotic spindle assembly checkpoint protein MAD1 OS=Mus musculus OX=10090 GN=Mad1l1 PE=1 SV=1
3	AFDB:Q6GPD1	0.285	0.285	5.220E-55	718	0.618	0.618	Q6GPD1.pdb.gz	Q6GPD1_XENLA Mad1-A protein OS=Xenopus laevis OX=8355 GN=mad1l1.L PE=1 SV=1
4	AFDB:Q7KND8	0.189	0.187	1.210E-17	730	0.231	0.227	Q7KND8.pdb.gz	Q7KND8_DROME FI09619p OS=Drosophila melanogaster OX=7227 GN=Mad1 PE=1 SV=1
5	AFDB:Q54JX0	0.162	0.144	1.021E-15	819	0.234	0.205	Q54JX0.pdb.gz	Q54JX0_DICDI Mitotic spindle assembly checkpoint protein 1 OS=Dictyostelium discoideum OX=44689 GN=mad1 PE=3 SV=1
6	AFDB:Q9LTY1	0.189	0.187	1.923E-15	726	0.221	0.219	Q9LTY1.pdb.gz	MAD1_ARATH Mitotic spindle checkpoint protein MAD1 OS=Arabidopsis thaliana OX=3702 GN=MAD1 PE=1 SV=1
7	AFDB:P87169	0.192	0.198	7.118E-14	689	0.223	0.232	P87169.pdb.gz	MAD1_SCHPO Spindle assembly checkpoint component mad1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mad1 PE=1 SV=1
8	AFDB:C8VRP6	0.160	0.172	2.926E-11	666	0.182	0.197	C8VRP6.pdb.gz	C8VRP6_EMENI Spindle assembly checkpoint component MAD1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00696 PE=3 SV=1
9	AFDB:P40957	0.168	0.162	5.175E-11	749	0.213	0.204	P40957.pdb.gz	MAD1_YEAST Spindle assembly checkpoint component MAD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MAD1 PE=1 SV=1
10	AFDB:Q54BH4	0.151	0.178	5.838E-2	575	0.107	0.134	Q54BH4.pdb.gz	Q54BH4_DICDI Spindle assembly checkpoint component MAD1 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0293620 PE=4 SV=1
11	PDB:7qooP	0.085	0.213	7.808E-2	233	0.031	0.094	7qooP.pdb.gz	Structure of the human inner kinetochore CCAN complex and its significance for human centromere organization.
12	PDB:3n7nB	0.117	0.322	2.020E-1	164	0.032	0.140	3n7nB.pdb.gz
13	PDB:5vhiC	0.064	0.120	5.224E-1	350	0.028	0.057	5vhiC.pdb.gz
14	PDB:3lp9A	0.045	0.126	8.140E-1	227	0.010	0.031	3lp9A.pdb.gz	Crystal structure and functional insights of hemopexin fold protein from grass pea
15	PDB:4it3A	0.053	0.126	9.239E-1	219	0.011	0.037	4it3A.pdb.gz
16	PDB:5u0pQ	0.078	0.101	9.844E-1	508	0.042	0.059	5u0pQ.pdb.gz
17	PDB:6fvtJ	0.059	0.095	9.844E-1	405	0.022	0.040	6fvtJ.pdb.gz	Expanded Coverage of the 26S Proteasome Conformational Landscape Reveals Mechanisms of Peptidase Gating.
18	PDB:7m8eF	0.043	0.034	9.844E-1	967	0.026	0.020	7m8eF.pdb.gz	Structural basis for activation of Swi2/Snf2 ATPase RapA by RNA polymerase.
19	PDB:7czeB	0.046	0.189	1.190	109	0.014	0.092	7czeB.pdb.gz
20	PDB:7r03B	0.036	0.015	1.190	2246	0.018	0.006	7r03B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6GPD1	0.0	853	718	0.618	0.618	Q6GPD1_XENLA Mad1-A protein OS=Xenopus laevis OX=8355 GN=mad1l1.L PE=1 SV=1
2	Q9WTX8	0.0	1144	717	0.811	0.812	MD1L1_MOUSE Mitotic spindle assembly checkpoint protein MAD1 OS=Mus musculus OX=10090 GN=Mad1l1 PE=1 SV=1
3	Q9Y6D9	0.0	1422	718	1.000	1.000	MD1L1_HUMAN Mitotic spindle assembly checkpoint protein MAD1 OS=Homo sapiens OX=9606 GN=MAD1L1 PE=1 SV=2
4	Q95S25	5.50e-38	153	730	0.195	0.192	Q95S25_DROME GM14169p OS=Drosophila melanogaster OX=7227 GN=Mad1 PE=2 SV=1
5	Q7KND8	5.98e-38	153	730	0.195	0.192	Q7KND8_DROME FI09619p OS=Drosophila melanogaster OX=7227 GN=Mad1 PE=1 SV=1
6	Q54JX0	1.24e-26	118	819	0.107	0.094	Q54JX0_DICDI Mitotic spindle assembly checkpoint protein 1 OS=Dictyostelium discoideum OX=44689 GN=mad1 PE=3 SV=1
7	P87169	5.05e-21	100	689	0.175	0.183	MAD1_SCHPO Spindle assembly checkpoint component mad1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mad1 PE=1 SV=1
8	Q9LTY1	2.74e-18	91.7	726	0.191	0.189	MAD1_ARATH Mitotic spindle checkpoint protein MAD1 OS=Arabidopsis thaliana OX=3702 GN=MAD1 PE=1 SV=1
9	C8VRP6	3.87e-12	72.0	666	0.205	0.221	C8VRP6_EMENI Spindle assembly checkpoint component MAD1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00696 PE=3 SV=1
10	Q8IDX6	6.29e-05	49.3	3130	0.061	0.014	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
11	Q9P219	0.012	41.6	2028	0.088	0.031	DAPLE_HUMAN Protein Daple OS=Homo sapiens OX=9606 GN=CCDC88C PE=1 SV=3
12	Q07DR3	0.019	40.8	1218	0.075	0.044	Q07DR3_DANRE Dynactin subunit 1 OS=Danio rerio OX=7955 GN=dctn1a PE=1 SV=1
13	P25386	0.67	35.8	1790	0.120	0.048	USO1_YEAST Intracellular protein transport protein USO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=USO1 PE=1 SV=2
14	Q7TT50	1.0	35.4	1713	0.095	0.040	MRCKB_MOUSE Serine/threonine-protein kinase MRCK beta OS=Mus musculus OX=10090 GN=Cdc42bpb PE=1 SV=2
15	Q7TT49	1.1	35.4	1713	0.093	0.039	MRCKB_RAT Serine/threonine-protein kinase MRCK beta OS=Rattus norvegicus OX=10116 GN=Cdc42bpb PE=1 SV=1
16	E9PD53	1.2	35.0	1263	0.100	0.057	E9PD53_HUMAN Structural maintenance of chromosomes protein OS=Homo sapiens OX=9606 GN=SMC4 PE=1 SV=1
17	Q9NTJ3	1.3	35.0	1288	0.100	0.056	SMC4_HUMAN Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4 PE=1 SV=2
18	P08928	1.5	34.7	622	0.053	0.061	LAM0_DROME Lamin Dm0 OS=Drosophila melanogaster OX=7227 GN=Lam PE=1 SV=4
19	P40957	2.5	33.9	749	0.043	0.041	MAD1_YEAST Spindle assembly checkpoint component MAD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MAD1 PE=1 SV=1
20	Q9VMA7	2.8	33.9	1430	0.053	0.027	TGO1_DROME Transport and Golgi organization protein 1 OS=Drosophila melanogaster OX=7227 GN=Tango1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11043 Anti-RecBCD_p2	4e+02	12.5	Bacteriophage P22, anti-RecBCD protein 2
2	PF13863 DUF4200	38	16.1	Domain of unknown function (DUF4200)
3	PF05557 MAD	6.8e-257	865.8	Mitotic checkpoint protein
4	PF12194 Ste5_C	3.9e+02	12.4	Protein kinase Fus3-binding
5	PF01166 TSC22	41	15.8	TSC-22/dip/bun family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000385334

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000296509	0.999	Mitotic spindle assembly checkpoint protein MAD2A
2	9606.ENSP00000356448	0.990	Nucleoprotein TPR
3	9606.ENSP00000358813	0.989	Dual specificity protein kinase TTK
4	9606.ENSP00000287598	0.987	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
5	9606.ENSP00000357858	0.987	Mitotic checkpoint protein BUB3
6	9606.ENSP00000302530	0.984	Mitotic checkpoint serine/threonine-protein kinase BUB1
7	9606.ENSP00000380820	0.968	Germinal-center associated nuclear protein
8	9606.ENSP00000479494	0.962	PCI domain containing 2
9	9606.ENSP00000316032	0.916	Nuclear pore complex protein Nup98-Nup96
10	9606.ENSP00000283195	0.912	E3 SUMO-protein ligase RanBP2
11	9606.ENSP00000428259	0.909	Centrin-3
12	9606.ENSP00000444029	0.908	Nuclear pore complex protein Nup153
13	9606.ENSP00000359300	0.906	Centrin-2
14	9606.ENSP00000429986	0.900	Transcription and mRNA export factor ENY2
15	9606.ENSP00000235310	0.894	Mitotic spindle assembly checkpoint protein MAD2B
16	9606.ENSP00000378529	0.891	Fizzy-related protein homolog
17	9606.ENSP00000394394	0.872	Anaphase-promoting complex subunit 7
18	9606.ENSP00000361540	0.836	Cell division cycle protein 20 homolog
19	9606.ENSP00000354361	0.814	E3 ubiquitin-protein ligase RFWD3
20	9606.ENSP00000410818	0.774	MAD2L1-binding protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0043515	0.954	kinetochore binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.977	cellular process
GO:0050794	0.977	regulation of cellular process
GO:0048523	0.945	negative regulation of cellular process
GO:0051726	0.935	regulation of cell cycle
GO:0033045	0.933	regulation of sister chromatid segregation
GO:0007094	0.924	mitotic spindle assembly checkpoint signaling
GO:1901976	0.907	regulation of cell cycle checkpoint
GO:0048522	0.858	positive regulation of cellular process
GO:0051179	0.834	localization
GO:0051641	0.819	cellular localization
GO:0010638	0.741	positive regulation of organelle organization
GO:0090068	0.709	positive regulation of cell cycle process
GO:1905820	0.662	positive regulation of chromosome separation
GO:0033036	0.630	macromolecule localization
GO:0008104	0.494	protein localization
GO:0071840	0.369	cellular component organization or biogenesis
GO:0019222	0.364	regulation of metabolic process
GO:0060255	0.342	regulation of macromolecule metabolic process
GO:0016043	0.319	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005634	1.000	nucleus
GO:0000776	1.000	kinetochore
GO:0005829	0.999	cytosol
GO:0000922	0.999	spindle pole
GO:0012505	0.994	endomembrane system
GO:0070013	0.950	intracellular organelle lumen
GO:0140513	0.950	nuclear protein-containing complex
GO:0005654	0.935	nucleoplasm
GO:1990728	0.771	mitotic spindle assembly checkpoint MAD1-MAD2 complex
GO:0031975	0.769	envelope
GO:0031967	0.758	organelle envelope
GO:1990706	0.740	MAD1 complex
GO:0005635	0.723	nuclear envelope
GO:0005643	0.694	nuclear pore
GO:0072686	0.691	mitotic spindle
GO:0044615	0.590	nuclear pore nuclear basket
GO:0016020	0.468	membrane
GO:0097431	0.394	mitotic spindle pole

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]