StarFunc result for job id Q9Y6E7

User Input

>input (314 residues)
MKMSFALTFRSAKGRWIANPSQPCSKASIGLFVPASPPLDPEKVKELQRFITLSKRLLVM
TGAGISTESGIPDYRSEKVGLYARTDRRPIQHGDFVRSAPIRQRYWARNFVGWPQFSSHQ
PNPAHWALSTWEKLGKLYWLVTQNVDALHTKAGSRRLTELHGCMDRVLCLDCGEQTPRGV
LQERFQVLNPTWSAEAHGLAPDGDVFLSEEQVRSFQVPTCVQCGGHLKPDVVFFGDTVNP
DKVDFVHKRVKEADSLLVVGSSLQVYSGYRFILTAWEKKLPIAILNIGPTRSDDLACLKL
NSRCGELLPLIDPC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y6E7	1.000	1.000	4.444E-68	314	1.000	1.000	Q9Y6E7.pdb.gz	SIR4_HUMAN NAD-dependent protein lipoamidase sirtuin-4, mitochondrial OS=Homo sapiens OX=9606 GN=SIRT4 PE=1 SV=1
2	AFDB:Q1JQC6	0.930	0.927	3.227E-62	315	0.898	0.895	Q1JQC6.pdb.gz	SIR4_BOVIN NAD-dependent protein lipoamidase sirtuin-4, mitochondrial OS=Bos taurus OX=9913 GN=SIRT4 PE=2 SV=1
3	AFDB:Q8R216	0.919	0.867	2.842E-60	333	0.854	0.805	Q8R216.pdb.gz	SIR4_MOUSE NAD-dependent protein lipoamidase sirtuin-4, mitochondrial OS=Mus musculus OX=10090 GN=Sirt4 PE=1 SV=3
4	AFDB:B2RZ30	0.763	0.846	6.330E-44	283	0.694	0.770	B2RZ30.pdb.gz	B2RZ30_RAT Sirt4 protein OS=Rattus norvegicus OX=10116 GN=Sirt4 PE=2 SV=1
5	AFDB:Q8IRR5	0.898	0.904	4.955E-43	312	0.465	0.468	Q8IRR5.pdb.gz	SIR4_DROME NAD-dependent protein deacylase Sirt4 OS=Drosophila melanogaster OX=7227 GN=Sirt4 PE=2 SV=2
6	AFDB:Q20480	0.874	0.955	3.406E-39	287	0.433	0.474	Q20480.pdb.gz	SIR41_CAEEL NAD-dependent protein deacylase sir-2.2 OS=Caenorhabditis elegans OX=6239 GN=sir-2.2 PE=1 SV=1
7	AFDB:Q20481	0.832	0.908	5.821E-36	287	0.385	0.422	Q20481.pdb.gz	SIR42_CAEEL NAD-dependent protein deacylase sir-2.3 OS=Caenorhabditis elegans OX=6239 GN=sir-2.3 PE=1 SV=1
8	AFDB:Q94AQ6	0.863	0.729	6.184E-36	373	0.401	0.338	Q94AQ6.pdb.gz	SIR4_ARATH NAD-dependent protein deacylase SRT2 OS=Arabidopsis thaliana OX=3702 GN=SRT2 PE=1 SV=1
9	AFDB:Q57YZ9	0.786	0.807	3.495E-27	306	0.328	0.337	Q57YZ9.pdb.gz	SIR4_TRYB2 NAD-dependent protein deacylase SIR2rp2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=SIR2rp2 PE=3 SV=1
10	AFDB:Q6DHI5	0.683	0.702	2.872E-22	305	0.252	0.259	Q6DHI5.pdb.gz	SIR5_DANRE NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Danio rerio OX=7955 GN=sirt5 PE=1 SV=1
11	PDB:3u31A	0.634	0.750	8.516E-20	263	0.229	0.274	3u31A.pdb.gz	Plasmodium falciparum Sir2A Preferentially Hydrolyzes Medium and Long Chain Fatty Acyl Lysine
12	PDB:7cl1A	0.598	0.633	1.149E-18	296	0.245	0.260	7cl1A.pdb.gz	Reply to: Binding site for MDL-801 on SIRT6.
13	PDB:6fkyB	0.648	0.753	2.848E-18	266	0.229	0.271	6fkyB.pdb.gz	Potent and Selective Inhibitors of Human Sirtuin 5.
14	PDB:5fyqA	0.620	0.685	2.348E-14	282	0.201	0.223	5fyqA.pdb.gz	Insights Into Lysine-Deacetylation of Natively Folded Substrate Proteins by Sirtuins.
15	PDB:1q14A	0.586	0.630	2.487E-13	289	0.175	0.190	1q14A.pdb.gz	Structure and autoregulation of the Yeast Hst2 homolog of Sir2
16	PDB:4o33A	0.268	0.212	1.238E-2	417	0.096	0.072	4o33A.pdb.gz	Terazosin activates Pgk1 and Hsp90 to promote stress resistance.
17	PDB:1qpgA	0.288	0.226	2.134E-2	415	0.086	0.065	1qpgA.pdb.gz	Structure of the R65Q mutant of yeast 3-phosphoglycerate kinase complexed with Mg-AMP-PNP and 3-phospho-D-glycerate.
18	PDB:2paaA	0.327	0.259	2.134E-2	413	0.080	0.061	2paaA.pdb.gz	X-ray analysis of phosphoglycerate kinase 2, a sperm-specific isoform from Mus musculus.
19	PDB:6lpiB	0.306	0.186	2.889E-2	539	0.108	0.063	6lpiB.pdb.gz	Molecular architecture of the acetohydroxyacid synthase holoenzyme.
20	PDB:3zlbA	0.325	0.263	3.464E-2	398	0.073	0.058	3zlbA.pdb.gz	Pneumococcal phosphoglycerate kinase interacts with plasminogen and its tissue activator.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K6D8	0.0	547	319	0.841	0.828	A0A0G2K6D8_RAT NAD-dependent protein lipoamidase sirtuin-4, mitochondrial OS=Rattus norvegicus OX=10116 GN=Sirt4 PE=3 SV=1
2	G3V641	0.0	546	311	0.841	0.849	G3V641_RAT NAD-dependent protein lipoamidase sirtuin-4, mitochondrial OS=Rattus norvegicus OX=10116 GN=Sirt4 PE=3 SV=1
3	Q1JQC6	0.0	576	315	0.898	0.895	SIR4_BOVIN NAD-dependent protein lipoamidase sirtuin-4, mitochondrial OS=Bos taurus OX=9913 GN=SIRT4 PE=2 SV=1
4	Q8R216	0.0	555	333	0.854	0.805	SIR4_MOUSE NAD-dependent protein lipoamidase sirtuin-4, mitochondrial OS=Mus musculus OX=10090 GN=Sirt4 PE=1 SV=3
5	Q9Y6E7	0.0	650	314	1.000	1.000	SIR4_HUMAN NAD-dependent protein lipoamidase sirtuin-4, mitochondrial OS=Homo sapiens OX=9606 GN=SIRT4 PE=1 SV=1
6	B2RZ30	1.93e-162	455	283	0.694	0.770	B2RZ30_RAT Sirt4 protein OS=Rattus norvegicus OX=10116 GN=Sirt4 PE=2 SV=1
7	Q8IRR5	2.66e-93	281	312	0.465	0.468	SIR4_DROME NAD-dependent protein deacylase Sirt4 OS=Drosophila melanogaster OX=7227 GN=Sirt4 PE=2 SV=2
8	Q20480	1.44e-92	278	287	0.443	0.484	SIR41_CAEEL NAD-dependent protein deacylase sir-2.2 OS=Caenorhabditis elegans OX=6239 GN=sir-2.2 PE=1 SV=1
9	Q20481	1.56e-82	253	287	0.385	0.422	SIR42_CAEEL NAD-dependent protein deacylase sir-2.3 OS=Caenorhabditis elegans OX=6239 GN=sir-2.3 PE=1 SV=1
10	Q94AQ6	5.00e-77	241	373	0.398	0.335	SIR4_ARATH NAD-dependent protein deacylase SRT2 OS=Arabidopsis thaliana OX=3702 GN=SRT2 PE=1 SV=1
11	Q57YZ9	1.73e-52	176	306	0.328	0.337	SIR4_TRYB2 NAD-dependent protein deacylase SIR2rp2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=SIR2rp2 PE=3 SV=1
12	Q8K2C6	7.34e-29	114	310	0.290	0.294	SIR5_MOUSE NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Mus musculus OX=10090 GN=Sirt5 PE=1 SV=1
13	Q9NXA8	1.75e-27	110	310	0.252	0.255	SIR5_HUMAN NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Homo sapiens OX=9606 GN=SIRT5 PE=1 SV=2
14	Q68FX9	7.90e-27	109	310	0.261	0.265	SIR5_RAT NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Rattus norvegicus OX=10116 GN=Sirt5 PE=2 SV=1
15	Q6DHI5	1.84e-26	108	305	0.245	0.252	SIR5_DANRE NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Danio rerio OX=7955 GN=sirt5 PE=1 SV=1
16	Q57V41	2.99e-25	105	351	0.236	0.211	SIR2_TRYB2 NAD-dependent protein deacetylase SIR2rp1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=SIR2rp1 PE=1 SV=1
17	Q8IE47	2.66e-23	99.0	273	0.229	0.264	SIR2A_PLAF7 NAD-dependent protein deacylase Sir2A OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=Sir2A PE=1 SV=1
18	A0R2N3	5.39e-23	97.4	240	0.236	0.308	NDP_MYCS2 NAD-dependent protein deacylase Sir2 OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=sir2 PE=1 SV=1
19	Q54QE6	2.42e-22	99.4	512	0.242	0.148	SIR2A_DICDI NAD-dependent deacetylase sir2A OS=Dictyostelium discoideum OX=44689 GN=sir2A PE=2 SV=1
20	P9WGG3	8.64e-22	94.0	237	0.226	0.300	NPD_MYCTU NAD-dependent protein deacylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cobB PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02146 SIR2	4.4e-49	178.4	Sir2 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000202967

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265986	0.985	Insulin-degrading enzyme
2	9606.ENSP00000222553	0.979	Nicotinamide phosphoribosyltransferase
3	9606.ENSP00000264663	0.967	NAD(P) transhydrogenase, mitochondrial
4	9606.ENSP00000277865	0.965	Glutamate dehydrogenase 1, mitochondrial
5	9606.ENSP00000441434	0.943	Nicotinamide N-methyltransferase
6	9606.ENSP00000371362	0.932	NAD kinase 2, mitochondrial
7	9606.ENSP00000326424	0.924	Glutamine-dependent NAD(+) synthetase
8	9606.ENSP00000327589	0.921	Glutamate dehydrogenase 2, mitochondrial
9	9606.ENSP00000354532	0.920	Purine nucleoside phosphorylase
10	9606.ENSP00000230792	0.912	Peroxisomal NADH pyrophosphatase NUDT12
11	9606.ENSP00000295757	0.909	Histone deacetylase 11
12	9606.ENSP00000360671	0.901	ADP/ATP translocase 2
13	9606.ENSP00000366410	0.872	Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1
14	9606.ENSP00000334061	0.860	Histone deacetylase 6
15	9606.ENSP00000340523	0.848	Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 3
16	9606.ENSP00000265016	0.837	ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2
17	9606.ENSP00000287713	0.833	Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2
18	9606.ENSP00000226279	0.824	ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
19	9606.ENSP00000264606	0.820	Histone deacetylase 4
20	9606.ENSP00000355759	0.792	Poly [ADP-ribose] polymerase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003950	1.000	NAD+ ADP-ribosyltransferase activity
GO:0033558	0.995	protein lysine deacetylase activity
GO:0016811	0.977	hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
GO:0034979	0.958	NAD-dependent protein deacetylase activity
GO:0016746	0.853	acyltransferase activity
GO:1990404	0.594	NAD+-protein ADP-ribosyltransferase activity
GO:0016747	0.575	acyltransferase activity, transferring groups other than amino-acyl groups
GO:0004407	0.442	histone deacetylase activity
GO:0019899	0.427	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0019222	0.996	regulation of metabolic process
GO:0009987	0.995	cellular process
GO:0048519	0.988	negative regulation of biological process
GO:0080090	0.985	regulation of primary metabolic process
GO:0050896	0.981	response to stimulus
GO:0048523	0.960	negative regulation of cellular process
GO:0051171	0.940	regulation of nitrogen compound metabolic process
GO:0009892	0.930	negative regulation of metabolic process
GO:0060255	0.873	regulation of macromolecule metabolic process
GO:0031323	0.862	regulation of cellular metabolic process
GO:0051716	0.833	cellular response to stimulus
GO:0010941	0.833	regulation of cell death
GO:0008152	0.832	metabolic process
GO:0010468	0.818	regulation of gene expression
GO:0051246	0.816	regulation of protein metabolic process
GO:0051172	0.805	negative regulation of nitrogen compound metabolic process
GO:0071704	0.788	organic substance metabolic process
GO:0044238	0.769	primary metabolic process
GO:0010605	0.716	negative regulation of macromolecule metabolic process
GO:0006807	0.679	nitrogen compound metabolic process
GO:0006950	0.638	response to stress
GO:0048518	0.635	positive regulation of biological process
GO:0010629	0.634	negative regulation of gene expression
GO:1903317	0.605	regulation of protein maturation
GO:0033554	0.514	cellular response to stress
GO:0071840	0.512	cellular component organization or biogenesis
GO:0048522	0.494	positive regulation of cellular process
GO:0044237	0.479	cellular metabolic process
GO:0016043	0.468	cellular component organization
GO:0043067	0.467	regulation of programmed cell death
GO:0009889	0.456	regulation of biosynthetic process
GO:0042981	0.456	regulation of apoptotic process
GO:0031324	0.436	negative regulation of cellular metabolic process
GO:0060548	0.424	negative regulation of cell death
GO:1901564	0.415	organonitrogen compound metabolic process
GO:0043066	0.396	negative regulation of apoptotic process
GO:0048583	0.361	regulation of response to stimulus
GO:0065009	0.346	regulation of molecular function
GO:0009893	0.346	positive regulation of metabolic process
GO:0042221	0.334	response to chemical
GO:0023051	0.333	regulation of signaling
GO:0010646	0.331	regulation of cell communication
GO:0010656	0.327	negative regulation of muscle cell apoptotic process
GO:0030162	0.316	regulation of proteolysis
GO:0050790	0.314	regulation of catalytic activity
GO:0031326	0.305	regulation of cellular biosynthetic process
GO:1903318	0.301	negative regulation of protein maturation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.998	intracellular organelle lumen
GO:0005759	0.887	mitochondrial matrix
GO:0005654	0.498	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.2.30	1.000	NAD(+) ADP-ribosyltransferase.
RHEA:58108	0.995	H2O + N(6)-acetyl-L-lysyl-[protein] = acetate + L-lysyl-[protein]
EC:3.5.1.-	0.977	In linear amides.
EC:2.3.-.-	0.853	Acyltransferases.
EC:2.3.1.-	0.575	Transferring groups other than amino-acyl groups.
RHEA:58196	0.442	H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone]
EC:3.5.1.98	0.442	histone deacetylase.

[back to server]