StarFunc result for job id Q9Y6F1

User Input

>input (533 residues)
MAPKPKPWVQTEGPEKKKGRQAGREEDPFRSTAEALKAIPAEKRIIRVDPTCPLSSNPGT
QVYEDYNCTLNQTNIENNNNKFYIIQLLQDSNRFFTCWNRWGRVGEVGQSKINHFTRLED
AKKDFEKKFREKTKNNWAERDHFVSHPGKYTLIEVQAEDEAQEAVVKVDRGPVRTVTKRV
QPCSLDPATQKLITNIFSKEMFKNTMALMDLDVKKMPLGKLSKQQIARGFEALEALEEAL
KGPTDGGQSLEELSSHFYTVIPHNFGHSQPPPINSPELLQAKKDMLLVLADIELAQALQA
VSEQEKTVEEVPHPLDRDYQLLKCQLQLLDSGAPEYKVIQTYLEQTGSNHRCPTLQHIWK
VNQEGEEDRFQAHSKLGNRKLLWHGTNMAVVAAILTSGLRIMPHSGGRVGKGIYFASENS
KSAGYVIGMKCGAHHVGYMFLGEVALGREHHINTDNPSLKSPPPGFDSVIARGHTEPDPT
QDTELELDGQQVVVPQGQPVPCPEFSSSTFSQSEYLIYQESQCRLRYLLEVHL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R318	0.975	0.975	3.190E-102	533	1.000	1.000	A0A024R318.pdb.gz
2	AFDB:Q3ULW8	0.917	0.917	3.156E-84	533	0.795	0.795	Q3ULW8.pdb.gz	PARP3_MOUSE Protein mono-ADP-ribosyltransferase PARP3 OS=Mus musculus OX=10090 GN=Parp3 PE=2 SV=1
3	AFDB:F1QSK1	0.896	0.899	7.007E-66	531	0.548	0.550	F1QSK1.pdb.gz
4	AFDB:Q8I7C6	0.800	0.617	7.806E-51	700	0.373	0.284	Q8I7C6.pdb.gz	Q8I7C6_DICDI Poly [ADP-ribose] polymerase OS=Dictyostelium discoideum OX=44689 GN=adprt2 PE=2 SV=1
5	AFDB:Q57ZY1	0.807	0.754	3.392E-49	573	0.360	0.335	Q57ZY1.pdb.gz	Q57ZY1_TRYB2 Poly [ADP-ribose] polymerase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.26K5.30 PE=4 SV=1
6	AFDB:Q9UGN5	0.801	0.735	5.091E-47	583	0.356	0.326	Q9UGN5.pdb.gz	PARP2_HUMAN Poly [ADP-ribose] polymerase 2 OS=Homo sapiens OX=9606 GN=PARP2 PE=1 SV=2
7	AFDB:Q11207	0.812	0.684	1.517E-45	637	0.325	0.272	Q11207.pdb.gz	PARP2_ARATH Poly [ADP-ribose] polymerase 2 OS=Arabidopsis thaliana OX=3702 GN=PARP2 PE=2 SV=1
8	AFDB:O88554	0.793	0.758	1.882E-45	559	0.338	0.322	O88554.pdb.gz	PARP2_MOUSE Poly [ADP-ribose] polymerase 2 OS=Mus musculus OX=10090 GN=Parp2 PE=1 SV=3
9	AFDB:P35875	0.805	0.441	4.002E-45	994	0.298	0.160	P35875.pdb.gz	PARP_DROME Poly [ADP-ribose] polymerase OS=Drosophila melanogaster OX=7227 GN=Parp PE=1 SV=1
10	AFDB:A0A024R3T8	0.795	0.428	6.859E-45	1014	0.328	0.173	A0A024R3T8.pdb.gz
11	PDB:6x0lP	0.742	0.829	1.510E-40	474	0.340	0.382	6x0lP.pdb.gz	Bridging of DNA breaks activates PARP2-HPF1 to modify chromatin.
12	PDB:1ikpA	0.181	0.165	7.553E-3	599	0.126	0.112	1ikpA.pdb.gz
13	PDB:6wgeA	0.073	0.093	9.506E-2	390	0.053	0.072	6wgeA.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
14	PDB:6wg3A	0.062	0.060	2.507E-1	561	0.034	0.032	6wg3A.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
15	PDB:5fl1A	0.099	0.082	2.947E-1	703	0.056	0.043	5fl1A.pdb.gz	Analysis of transition state mimicry by tight binding aminothiazoline inhibitors provides insight into catalysis by humanO-GlcNAcase.
16	PDB:2fd5A	0.069	0.144	3.859E-1	180	0.051	0.150	2fd5A.pdb.gz
17	PDB:7krwA	0.088	0.080	4.787E-1	608	0.045	0.039	7krwA.pdb.gz	Conformational equilibria in allosteric control of Hsp70 chaperones.
18	PDB:6rqxA	0.069	0.049	5.331E-1	862	0.023	0.014	6rqxA.pdb.gz	Mechanism for antigenic peptide selection by endoplasmic reticulum aminopeptidase 1.
19	PDB:7d3eB	0.077	0.134	5.331E-1	272	0.066	0.129	7d3eB.pdb.gz	Structures of human dual oxidase 1 complex in low-calcium and high-calcium states.
20	PDB:3mdjC	0.059	0.043	5.626E-1	819	0.024	0.016	3mdjC.pdb.gz	Structural basis for antigenic peptide precursor processing by the endoplasmic reticulum aminopeptidase ERAP1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C9J9C7	0.0	689	331	0.621	1.000	C9J9C7_HUMAN Protein mono-ADP-ribosyltransferase PARP3 (Fragment) OS=Homo sapiens OX=9606 GN=PARP3 PE=1 SV=8
2	Q3ULW8	0.0	753	533	0.807	0.807	PARP3_MOUSE Protein mono-ADP-ribosyltransferase PARP3 OS=Mus musculus OX=10090 GN=Parp3 PE=2 SV=1
3	Q7ZVB0	0.0	521	531	0.552	0.554	Q7ZVB0_DANRE Poly [ADP-ribose] polymerase OS=Danio rerio OX=7955 GN=fj17c06 PE=1 SV=2
4	Q9Y6F1	0.0	1116	533	1.000	1.000	PARP3_HUMAN Protein mono-ADP-ribosyltransferase PARP3 OS=Homo sapiens OX=9606 GN=PARP3 PE=1 SV=4
5	Q8I7C6	5.52e-100	318	700	0.368	0.280	Q8I7C6_DICDI Poly [ADP-ribose] polymerase OS=Dictyostelium discoideum OX=44689 GN=adprt2 PE=2 SV=1
6	Q57ZY1	1.83e-87	282	573	0.345	0.321	Q57ZY1_TRYB2 Poly [ADP-ribose] polymerase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.26K5.30 PE=4 SV=1
7	G3V749	8.36e-85	275	558	0.351	0.335	G3V749_RAT Poly (ADP-ribose) polymerase 2 OS=Rattus norvegicus OX=10116 GN=Parp2 PE=3 SV=1
8	O88554	1.24e-84	275	559	0.343	0.327	PARP2_MOUSE Poly [ADP-ribose] polymerase 2 OS=Mus musculus OX=10090 GN=Parp2 PE=1 SV=3
9	Q11207	1.57e-81	268	637	0.326	0.273	PARP2_ARATH Poly [ADP-ribose] polymerase 2 OS=Arabidopsis thaliana OX=3702 GN=PARP2 PE=2 SV=1
10	Q9UGN5	1.72e-80	264	583	0.345	0.316	PARP2_HUMAN Poly [ADP-ribose] polymerase 2 OS=Homo sapiens OX=9606 GN=PARP2 PE=1 SV=2
11	G3V167	2.32e-74	247	531	0.319	0.320	G3V167_HUMAN Poly [ADP-ribose] polymerase OS=Homo sapiens OX=9606 GN=PARP2 PE=1 SV=1
12	P09874	5.37e-72	249	1014	0.321	0.169	PARP1_HUMAN Poly [ADP-ribose] polymerase 1 OS=Homo sapiens OX=9606 GN=PARP1 PE=1 SV=4
13	P27008	8.72e-71	246	1014	0.315	0.166	PARP1_RAT Poly [ADP-ribose] polymerase 1 OS=Rattus norvegicus OX=10116 GN=Parp1 PE=1 SV=4
14	Q9N4H4	2.12e-69	241	945	0.313	0.177	PARP1_CAEEL Poly [ADP-ribose] polymerase 1 OS=Caenorhabditis elegans OX=6239 GN=parp-1 PE=1 SV=1
15	P35875	1.14e-68	240	994	0.308	0.165	PARP_DROME Poly [ADP-ribose] polymerase OS=Drosophila melanogaster OX=7227 GN=Parp PE=1 SV=1
16	Q5RHR0	1.14e-68	240	1013	0.311	0.164	PARP1_DANRE Poly [ADP-ribose] polymerase 1 OS=Danio rerio OX=7955 GN=parp1 PE=2 SV=1
17	P11103	1.28e-68	240	1013	0.306	0.161	PARP1_MOUSE Poly [ADP-ribose] polymerase 1 OS=Mus musculus OX=10090 GN=Parp1 PE=1 SV=3
18	P26446	1.11e-66	235	1011	0.317	0.167	PARP1_CHICK Poly [ADP-ribose] polymerase 1 OS=Gallus gallus OX=9031 GN=PARP1 PE=1 SV=2
19	Q9ZP54	1.08e-60	218	983	0.295	0.160	PARP1_ARATH Poly [ADP-ribose] polymerase 1 OS=Arabidopsis thaliana OX=3702 GN=PARP1 PE=1 SV=2
20	Q54XI2	6.51e-60	215	938	0.293	0.166	Q54XI2_DICDI Poly [ADP-ribose] polymerase OS=Dictyostelium discoideum OX=44689 GN=adprt1A PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09469 Cobl	4.6e+02	12.6	Cordon-bleu ubiquitin-like domain
2	PF00644 PARP	4.6e-42	155.3	Poly(ADP-ribose) polymerase catalytic domain
3	PF02877 PARP_reg	6e-38	141.5	Poly(ADP-ribose) polymerase, regulatory domain
4	PF05406 WGR	2.3e-25	99.8	WGR domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000381740

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000384408	0.906	Poly(ADP-ribose) glycohydrolase
2	9606.ENSP00000456348	0.855	poly(ADP-ribose) polymerase family member 6
3	9606.ENSP00000311032	0.839	Caspase-3
4	9606.ENSP00000307004	0.829	Aprataxin and PNK-like factor
5	9606.ENSP00000358327	0.826	Caspase-7
6	9606.ENSP00000281631	0.824	poly(ADP-ribose) polymerase family member 8
7	9606.ENSP00000261888	0.822	Mono [ADP-ribose] polymerase PARP16
8	9606.ENSP00000352257	0.818	X-ray repair cross-complementing protein 6
9	9606.ENSP00000330237	0.815	Caspase-9
10	9606.ENSP00000216341	0.800	Granzyme B
11	9606.ENSP00000325618	0.758	Poly [ADP-ribose] polymerase 10
12	9606.ENSP00000311579	0.728	Tankyrase-1
13	9606.ENSP00000422375	0.723	U8 snoRNA-decapping enzyme
14	9606.ENSP00000360689	0.722	Tankyrase-2
15	9606.ENSP00000353512	0.721	Poly [ADP-ribose] polymerase 9
16	9606.ENSP00000367787	0.721	DNA ligase 3
17	9606.ENSP00000263549	0.709	poly(ADP-ribose) polymerase family member 12
18	9606.ENSP00000417214	0.704	Poly [ADP-ribose] polymerase 15
19	9606.ENSP00000262887	0.697	DNA repair protein XRCC1
20	9606.ENSP00000242351	0.693	Zinc finger CCCH-type antiviral protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003950	1.000	NAD+ ADP-ribosyltransferase activity
GO:1990404	1.000	NAD+-protein ADP-ribosyltransferase activity
GO:0005515	0.999	protein binding
GO:0097159	0.406	organic cyclic compound binding
GO:1901363	0.405	heterocyclic compound binding
GO:0140806	0.350	NAD+- protein-aspartate ADP-ribosyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0051716	0.997	cellular response to stimulus
GO:0051052	0.997	regulation of DNA metabolic process
GO:0006950	0.996	response to stress
GO:0006259	0.996	DNA metabolic process
GO:0048519	0.995	negative regulation of biological process
GO:0006974	0.993	cellular response to DNA damage stimulus
GO:0051053	0.985	negative regulation of DNA metabolic process
GO:0048583	0.970	regulation of response to stimulus
GO:0006281	0.958	DNA repair
GO:0048518	0.939	positive regulation of biological process
GO:0006302	0.923	double-strand break repair
GO:0048522	0.911	positive regulation of cellular process
GO:2001020	0.879	regulation of response to DNA damage stimulus
GO:0043412	0.851	macromolecule modification
GO:0031326	0.810	regulation of cellular biosynthetic process
GO:1901564	0.791	organonitrogen compound metabolic process
GO:0019538	0.715	protein metabolic process
GO:0036211	0.696	protein modification process
GO:0071840	0.611	cellular component organization or biogenesis
GO:0048584	0.583	positive regulation of response to stimulus
GO:0016043	0.555	cellular component organization
GO:0010604	0.528	positive regulation of macromolecule metabolic process
GO:0065009	0.518	regulation of molecular function
GO:0051173	0.516	positive regulation of nitrogen compound metabolic process
GO:0051128	0.469	regulation of cellular component organization
GO:0010556	0.461	regulation of macromolecule biosynthetic process
GO:0031325	0.453	positive regulation of cellular metabolic process
GO:0043687	0.453	post-translational protein modification
GO:0010468	0.448	regulation of gene expression
GO:0050790	0.331	regulation of catalytic activity
GO:0006996	0.315	organelle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.988	intracellular non-membrane-bounded organelle
GO:0045171	0.968	intercellular bridge
GO:0016604	0.959	nuclear body
GO:0005694	0.920	chromosome
GO:0035861	0.521	site of double-strand break

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.2.30	1.000	NAD(+) ADP-ribosyltransferase.

[back to server]