StarFunc result for job id Q9Y6F9

User Input

>input (365 residues)
MLPPLPSRLGLLLLLLLCPAHVGGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPE
VVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRILQQDIRETAFVFAITAAGASHAV
TQACSMGELLQCGCQAPRGRAPPRPSGLPGTPGPPGPAGSPEGSAAWEWGGCGDDVDFGD
EKSRLFMDARHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKL
PPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRT
GSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKE
LSLCL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y6F9	1.000	1.000	5.740E-65	365	1.000	1.000	Q9Y6F9.pdb.gz	WNT6_HUMAN Protein Wnt-6 OS=Homo sapiens OX=9606 GN=WNT6 PE=1 SV=2
2	AFDB:Q3C2H6	0.836	0.864	1.225E-48	353	0.723	0.748	Q3C2H6.pdb.gz	Q3C2H6_CHICK Protein Wnt OS=Gallus gallus OX=9031 GN=Wnt6 PE=2 SV=1
3	AFDB:Q9VM26	0.800	0.700	9.155E-35	420	0.444	0.386	Q9VM26.pdb.gz	Q9VM26_DROME Protein Wnt OS=Drosophila melanogaster OX=7227 GN=Wnt6 PE=2 SV=3
4	AFDB:Q93097	0.786	0.736	2.955E-34	391	0.392	0.366	Q93097.pdb.gz	WNT2B_HUMAN Protein Wnt-2b OS=Homo sapiens OX=9606 GN=WNT2B PE=1 SV=2
5	AFDB:D4A9J2	0.756	0.746	1.363E-33	370	0.458	0.451	D4A9J2.pdb.gz	D4A9J2_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt1 PE=3 SV=1
6	AFDB:Q98SN7	0.785	0.746	5.125E-33	385	0.359	0.340	Q98SN7.pdb.gz	WNT2B_CHICK Protein Wnt-2b OS=Gallus gallus OX=9031 GN=WNT2B PE=1 SV=1
7	AFDB:F1QK98	0.750	0.750	3.208E-32	365	0.405	0.405	F1QK98.pdb.gz
8	AFDB:P49337	0.781	0.811	3.376E-32	351	0.381	0.396	P49337.pdb.gz	WNT4_CHICK Protein Wnt-4 OS=Gallus gallus OX=9031 GN=WNT4 PE=1 SV=1
9	AFDB:A1BPR0	0.767	0.750	4.139E-32	374	0.397	0.388	A1BPR0.pdb.gz	A1BPR0_DANRE Protein Wnt OS=Danio rerio OX=7955 GN=wnt5a PE=2 SV=1
10	AFDB:B3DFK5	0.766	0.724	4.583E-32	387	0.384	0.362	B3DFK5.pdb.gz
11	PDB:6ahyB	0.713	0.824	6.900E-28	313	0.364	0.425	6ahyB.pdb.gz
12	PDB:4f0aB	0.698	0.857	8.915E-23	294	0.315	0.391	4f0aB.pdb.gz	Structural basis of Wnt recognition by Frizzled.
13	PDB:6w2xB	0.134	0.088	4.264	669	0.047	0.025	6w2xB.pdb.gz	Structures of metabotropic GABABreceptor.
14	PDB:3b07B	0.065	0.084	5.502	270	0.008	0.011	3b07B.pdb.gz
15	PDB:5apnP	0.066	0.115	5.789	183	0.005	0.011	5apnP.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
16	PDB:6uzbA	0.076	0.051	6.092	562	0.005	0.004	6uzbA.pdb.gz	Atomic structures of anthrax toxin protective antigen channels bound to partially unfolded lethal and edema factors.
17	PDB:6sb3A	0.076	0.049	6.410	604	0.008	0.005	6sb3A.pdb.gz
18	PDB:7rroF1	0.075	0.068	6.410	421	0.038	0.033	7rroF1.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
19	PDB:3ucaA	0.109	0.137	6.745	274	0.025	0.033	3ucaA.pdb.gz
20	PDB:8a1dA	0.062	0.045	6.745	533	0.016	0.011	8a1dA.pdb.gz	Cryo-EM structures of perforin-2 in isolation and assembled on a membrane suggest a mechanism for pore formation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P22727	0.0	712	364	0.975	0.978	WNT6_MOUSE Protein Wnt-6 OS=Mus musculus OX=10090 GN=Wnt6 PE=1 SV=2
2	Q3C2H6	0.0	558	353	0.723	0.748	Q3C2H6_CHICK Protein Wnt OS=Gallus gallus OX=9031 GN=Wnt6 PE=2 SV=1
3	Q9Y6F9	0.0	730	365	1.000	1.000	WNT6_HUMAN Protein Wnt-6 OS=Homo sapiens OX=9606 GN=WNT6 PE=1 SV=2
4	P56705	1.63e-96	293	351	0.427	0.444	WNT4_HUMAN Protein Wnt-4 OS=Homo sapiens OX=9606 GN=WNT4 PE=1 SV=4
5	P22724	3.76e-96	291	351	0.427	0.444	WNT4_MOUSE Protein Wnt-4 OS=Mus musculus OX=10090 GN=Wnt4 PE=1 SV=1
6	P49337	2.11e-95	290	351	0.419	0.436	WNT4_CHICK Protein Wnt-4 OS=Gallus gallus OX=9031 GN=WNT4 PE=1 SV=1
7	P47793	5.36e-95	289	352	0.430	0.446	WNT4A_DANRE Protein Wnt-4a OS=Danio rerio OX=7955 GN=wnt4a PE=2 SV=1
8	Q9QXQ5	7.76e-95	288	351	0.422	0.439	WNT4_RAT Protein Wnt-4 OS=Rattus norvegicus OX=10116 GN=Wnt4 PE=2 SV=1
9	P10108	4.01e-93	285	371	0.414	0.407	WNT1_XENLA Protein Wnt-1 OS=Xenopus laevis OX=8355 GN=wnt1 PE=2 SV=1
10	P49338	4.02e-93	284	351	0.411	0.427	WNT4_XENLA Protein Wnt-4 OS=Xenopus laevis OX=8355 GN=wnt4 PE=2 SV=1
11	Q3L254	2.97e-92	281	349	0.389	0.407	WNT7B_CHICK Protein Wnt-7b OS=Gallus gallus OX=9031 GN=WNT7B PE=2 SV=1
12	P24257	3.05e-92	282	370	0.427	0.422	WNT1_DANRE Protein Wnt-1 OS=Danio rerio OX=7955 GN=wnt1 PE=2 SV=1
13	Q98SN7	4.73e-92	282	385	0.378	0.358	WNT2B_CHICK Protein Wnt-2b OS=Gallus gallus OX=9031 GN=WNT2B PE=1 SV=1
14	Q8AY89	1.94e-91	281	387	0.384	0.362	Q8AY89_DANRE Protein Wnt OS=Danio rerio OX=7955 GN=wnt2b PE=2 SV=1
15	Q91029	1.91e-90	278	368	0.433	0.429	WNT1_CHICK Protein Wnt-1 OS=Gallus gallus OX=9031 GN=WNT1 PE=1 SV=3
16	P56706	2.67e-90	276	349	0.397	0.415	WNT7B_HUMAN Protein Wnt-7b OS=Homo sapiens OX=9606 GN=WNT7B PE=1 SV=2
17	Q93097	3.25e-90	278	391	0.392	0.366	WNT2B_HUMAN Protein Wnt-2b OS=Homo sapiens OX=9606 GN=WNT2B PE=1 SV=2
18	A0A0G2K3B7	6.66e-90	276	353	0.403	0.416	A0A0G2K3B7_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt7b PE=3 SV=1
19	P28047	2.09e-89	274	349	0.397	0.415	WNT7B_MOUSE Protein Wnt-7b OS=Mus musculus OX=10090 GN=Wnt7b PE=1 SV=1
20	Q5NSW6	2.09e-89	274	349	0.397	0.415	Q5NSW6_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt7b PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00110 wnt	2.1e-114	393.8	wnt family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000233948

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000322304	0.971	Protein-serine O-palmitoleoyltransferase porcupine
2	9606.ENSP00000258411	0.916	Protein Wnt-10a
3	9606.ENSP00000301061	0.914	Protein Wnt-10b
4	9606.ENSP00000325526	0.914	Protein Wnt-11
5	9606.ENSP00000272164	0.913	Protein Wnt-9a
6	9606.ENSP00000290015	0.913	Protein Wnt-9b
7	9606.ENSP00000293549	0.912	Proto-oncogene Wnt-1
8	9606.ENSP00000340677	0.911	Protein Wnt-8b
9	9606.ENSP00000426653	0.911	Protein Wnt-8a
10	9606.ENSP00000274063	0.910	Secreted frizzled-related protein 2
11	9606.ENSP00000284523	0.910	Protein Wnt-3a
12	9606.ENSP00000285018	0.909	Protein Wnt-7a
13	9606.ENSP00000222462	0.908	Protein Wnt-16
14	9606.ENSP00000225512	0.908	Proto-oncogene Wnt-3
15	9606.ENSP00000265441	0.908	Protein Wnt-2
16	9606.ENSP00000341032	0.908	Protein Wnt-7b
17	9606.ENSP00000264634	0.907	Protein Wnt-5a
18	9606.ENSP00000380379	0.907	Protein Wnt-5b
19	9606.ENSP00000290167	0.906	Protein Wnt-4
20	9606.ENSP00000358698	0.906	Protein Wnt-2b

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0030546	0.975	signaling receptor activator activity
GO:0048018	0.973	receptor ligand activity
GO:0001664	0.779	G protein-coupled receptor binding
GO:0005109	0.573	frizzled binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.987	response to stimulus
GO:0048518	0.986	positive regulation of biological process
GO:0048513	0.986	animal organ development
GO:0007275	0.986	multicellular organism development
GO:0050794	0.985	regulation of cellular process
GO:0051716	0.982	cellular response to stimulus
GO:0009888	0.979	tissue development
GO:0198738	0.979	cell-cell signaling by wnt
GO:0009653	0.971	anatomical structure morphogenesis
GO:0007165	0.965	signal transduction
GO:0048731	0.957	system development
GO:0007166	0.944	cell surface receptor signaling pathway
GO:0010604	0.942	positive regulation of macromolecule metabolic process
GO:0009887	0.938	animal organ morphogenesis
GO:0010468	0.935	regulation of gene expression
GO:1905114	0.921	cell surface receptor signaling pathway involved in cell-cell signaling
GO:0048522	0.843	positive regulation of cellular process
GO:0001822	0.836	kidney development
GO:0016055	0.830	Wnt signaling pathway
GO:0001763	0.785	morphogenesis of a branching structure
GO:0050793	0.777	regulation of developmental process
GO:0051171	0.772	regulation of nitrogen compound metabolic process
GO:0051239	0.766	regulation of multicellular organismal process
GO:0080090	0.766	regulation of primary metabolic process
GO:0001823	0.753	mesonephros development
GO:0070167	0.742	regulation of biomineral tissue development
GO:0061333	0.735	renal tubule morphogenesis
GO:0060993	0.734	kidney morphogenesis
GO:0072006	0.731	nephron development
GO:0072073	0.718	kidney epithelium development
GO:0072171	0.697	mesonephric tubule morphogenesis
GO:0031323	0.696	regulation of cellular metabolic process
GO:0048754	0.681	branching morphogenesis of an epithelial tube
GO:0048519	0.638	negative regulation of biological process
GO:0010556	0.638	regulation of macromolecule biosynthetic process
GO:0019219	0.630	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.625	regulation of cellular biosynthetic process
GO:0060675	0.623	ureteric bud morphogenesis
GO:2001141	0.618	regulation of RNA biosynthetic process
GO:0006355	0.612	regulation of DNA-templated transcription
GO:0001658	0.564	branching involved in ureteric bud morphogenesis
GO:0051173	0.561	positive regulation of nitrogen compound metabolic process
GO:0048523	0.550	negative regulation of cellular process
GO:0031325	0.512	positive regulation of cellular metabolic process
GO:0042476	0.501	odontogenesis
GO:0060070	0.496	canonical Wnt signaling pathway
GO:0051094	0.452	positive regulation of developmental process
GO:0030154	0.436	cell differentiation
GO:0010557	0.429	positive regulation of macromolecule biosynthetic process
GO:0045893	0.402	positive regulation of DNA-templated transcription
GO:0048583	0.370	regulation of response to stimulus
GO:0010628	0.370	positive regulation of gene expression
GO:0023051	0.362	regulation of signaling
GO:0010646	0.362	regulation of cell communication
GO:0009966	0.341	regulation of signal transduction
GO:0007399	0.308	nervous system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0071944	0.998	cell periphery
GO:0005576	0.993	extracellular region
GO:0070013	0.990	intracellular organelle lumen
GO:0005783	0.972	endoplasmic reticulum
GO:0005886	0.971	plasma membrane
GO:0005788	0.943	endoplasmic reticulum lumen
GO:0005615	0.840	extracellular space
GO:0031090	0.770	organelle membrane
GO:0031982	0.756	vesicle
GO:0032991	0.738	protein-containing complex
GO:0031410	0.725	cytoplasmic vesicle
GO:0030659	0.723	cytoplasmic vesicle membrane
GO:0098588	0.654	bounding membrane of organelle
GO:0005794	0.639	Golgi apparatus
GO:0009986	0.481	cell surface
GO:0031981	0.469	nuclear lumen
GO:0031012	0.461	extracellular matrix
GO:0005654	0.448	nucleoplasm
GO:0043230	0.345	extracellular organelle
GO:0030139	0.334	endocytic vesicle
GO:0030666	0.311	endocytic vesicle membrane
GO:1903561	0.310	extracellular vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]