StarFunc result for job id Q9Y6G9

User Input

>input (523 residues)
MAAVGRVGSFGSSPPGLSSTYTGGPLGNEIASGNGGAAAGDDEDGQNLWSCILSEVSTRS
RSKLPAGKNVLLLGEDGAGKTSLIRKIQGIEEYKKGRGLEYLYLNVHDEDRDDQTRCNVW
ILDGDLYHKGLLKFSLDAVSLKDTLVMLVVDMSKPWTALDSLQKWASVVREHVDKLKIPP
EEMKQMEQKLIRDFQEYVEPGEDFPASPQRRNTASQEDKDDSVVLPLGADTLTHNLGIPV
LVVCTKCDAISVLEKEHDYRDEHFDFIQSHIRKFCLQYGAALIYTSVKENKNIDLVYKYI
VQKLYGFPYKIPAVVVEKDAVFIPAGWDNDKKIGILHENFQTLKAEDNFEDIITKPPVRK
FVHEKEIMAEDDQVFLMKLQSLLAKQPPTAAGRPVDASPRVPGGSPRTPNRSVSSNVASV
SPIPAGSKKIDPNMKAGATSEGVLANFFNSLLSKKTGSPGGPGVSGGSPAGGAGGGSSGL
PPSTKKSGQKPVLDVHAELDRITRKPVTVSPTTPTSPTEGEAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9QXU8	0.725	0.725	5.418E-87	523	0.945	0.945	Q9QXU8.pdb.gz	DC1L1_RAT Cytoplasmic dynein 1 light intermediate chain 1 OS=Rattus norvegicus OX=10116 GN=Dync1li1 PE=1 SV=1
2	AFDB:Q1LUM9	0.684	0.713	1.620E-69	501	0.635	0.663	Q1LUM9.pdb.gz	Q1LUM9_DANRE Dynein light intermediate chain OS=Danio rerio OX=7955 GN=dncli2 PE=1 SV=1
3	AFDB:F1RB89	0.660	0.690	9.430E-67	500	0.642	0.672	F1RB89.pdb.gz	F1RB89_DANRE Dynein light intermediate chain OS=Danio rerio OX=7955 GN=fc08b04 PE=1 SV=1
4	AFDB:Q62698	0.657	0.690	6.212E-64	497	0.616	0.648	Q62698.pdb.gz	DC1L2_RAT Cytoplasmic dynein 1 light intermediate chain 2 OS=Rattus norvegicus OX=10116 GN=Dync1li2 PE=1 SV=1
5	AFDB:Q9VZ20	0.618	0.654	4.023E-48	493	0.421	0.446	Q9VZ20.pdb.gz	Q9VZ20_DROME Dynein light intermediate chain OS=Drosophila melanogaster OX=7227 GN=Dlic PE=1 SV=2
6	PDB:7z8fj	0.545	0.847	4.361E-48	330	0.480	0.761	7z8fj.pdb.gz	Structure of dynein-dynactin on microtubules shows tandem adaptor binding.
7	AFDB:G5ED34	0.554	0.647	6.191E-32	443	0.260	0.307	G5ED34.pdb.gz	G5ED34_CAEEL Dynein light intermediate chain OS=Caenorhabditis elegans OX=6239 GN=dli-1 PE=1 SV=1
8	AFDB:C8VB15	0.501	0.517	6.580E-24	505	0.218	0.226	C8VB15.pdb.gz	C8VB15_EMENI Dynein light intermediate chain (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_04664 PE=4 SV=1
9	AFDB:Q7SXY4	0.393	0.560	3.037E-18	358	0.140	0.204	Q7SXY4.pdb.gz	DC2L1_DANRE Cytoplasmic dynein 2 light intermediate chain 1 OS=Danio rerio OX=7955 GN=dync2li1 PE=2 SV=1
10	AFDB:Q6AY43	0.399	0.580	1.714E-17	351	0.143	0.214	Q6AY43.pdb.gz	DC2L1_RAT Cytoplasmic dynein 2 light intermediate chain 1 OS=Rattus norvegicus OX=10116 GN=Dync2li1 PE=1 SV=2
11	AFDB:Q19119	0.415	0.571	3.544E-16	370	0.113	0.159	Q19119.pdb.gz	Q19119_CAEEL Cytoplasmic dynein 2 light intermediate chain 1 OS=Caenorhabditis elegans OX=6239 GN=xbx-1 PE=3 SV=2
12	PDB:6rlbE	0.418	0.669	1.693E-15	312	0.145	0.244	6rlbE.pdb.gz
13	PDB:6s5hA	0.233	0.631	1.406E-7	175	0.075	0.223	6s5hA.pdb.gz	Structure of the human RAB38 in complex with GTP
14	PDB:4cz2B	0.257	0.665	3.139E-7	179	0.084	0.246	4cz2B.pdb.gz	Varp is Recruited on to Endosomes by Direct Interaction with Retromer, Where Together They Function in Export to the Cell Surface.
15	PDB:1uptG	0.245	0.646	6.196E-7	170	0.065	0.200	1uptG.pdb.gz	Structural Basis for Arl1-Dependent Targeting of Homodimeric Grip Domains to the Golgi Apparatus
16	PDB:6hxuA	0.233	0.594	9.550E-7	182	0.059	0.170	6hxuA.pdb.gz	A Targeted Protein Degradation Cell-Based Screening for Nanobodies Selective toward the Cellular RHOB GTP-Bound Conformation.
17	PDB:6jikA	0.264	0.671	1.384E-6	182	0.065	0.187	6jikA.pdb.gz	Aspergillus fumigatus Rho1 gSGTP complex
18	PDB:2wkpA	0.268	0.412	1.666E-6	320	0.067	0.109	2wkpA.pdb.gz	A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
19	PDB:5c2kA	0.248	0.327	2.005E-6	382	0.055	0.076	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
20	PDB:2f9mA	0.256	0.671	2.414E-6	182	0.069	0.198	2f9mA.pdb.gz	The crystal structure of the small GTPase Rab11b reveals critical differences relative to the Rab11a isoform.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4ICI6	0.0	654	491	0.606	0.646	A0A0R4ICI6_DANRE Dynein light intermediate chain OS=Danio rerio OX=7955 GN=dncli2 PE=1 SV=1
2	F1RB89	0.0	657	500	0.633	0.662	F1RB89_DANRE Dynein light intermediate chain OS=Danio rerio OX=7955 GN=fc08b04 PE=1 SV=1
3	O43237	0.0	634	492	0.612	0.650	DC1L2_HUMAN Cytoplasmic dynein 1 light intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1LI2 PE=1 SV=1
4	Q1LUM9	0.0	678	501	0.621	0.649	Q1LUM9_DANRE Dynein light intermediate chain OS=Danio rerio OX=7955 GN=dncli2 PE=1 SV=1
5	Q62698	0.0	634	497	0.608	0.640	DC1L2_RAT Cytoplasmic dynein 1 light intermediate chain 2 OS=Rattus norvegicus OX=10116 GN=Dync1li2 PE=1 SV=1
6	Q6PDL0	0.0	656	492	0.629	0.669	DC1L2_MOUSE Cytoplasmic dynein 1 light intermediate chain 2 OS=Mus musculus OX=10090 GN=Dync1li2 PE=1 SV=2
7	Q9QXU8	0.0	951	523	0.937	0.937	DC1L1_RAT Cytoplasmic dynein 1 light intermediate chain 1 OS=Rattus norvegicus OX=10116 GN=Dync1li1 PE=1 SV=1
8	Q9Y6G9	0.0	1071	523	1.000	1.000	DC1L1_HUMAN Cytoplasmic dynein 1 light intermediate chain 1 OS=Homo sapiens OX=9606 GN=DYNC1LI1 PE=1 SV=3
9	Q9VZ20	1.45e-130	390	493	0.417	0.442	Q9VZ20_DROME Dynein light intermediate chain OS=Drosophila melanogaster OX=7227 GN=Dlic PE=1 SV=2
10	Q8IR93	1.54e-98	305	398	0.340	0.447	Q8IR93_DROME Dynein light intermediate chain OS=Drosophila melanogaster OX=7227 GN=Dlic PE=1 SV=1
11	G5ED34	5.35e-48	174	443	0.235	0.278	G5ED34_CAEEL Dynein light intermediate chain OS=Caenorhabditis elegans OX=6239 GN=dli-1 PE=1 SV=1
12	G5ECK7	1.96e-47	172	441	0.233	0.277	G5ECK7_CAEEL Dynein light intermediate chain OS=Caenorhabditis elegans OX=6239 GN=dli-1 PE=1 SV=1
13	C8VB15	8.50e-25	109	505	0.174	0.180	C8VB15_EMENI Dynein light intermediate chain (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_04664 PE=4 SV=1
14	Q7SXY4	6.91e-09	60.1	358	0.149	0.218	DC2L1_DANRE Cytoplasmic dynein 2 light intermediate chain 1 OS=Danio rerio OX=7955 GN=dync2li1 PE=2 SV=1
15	Q8K0T2	7.99e-07	53.5	351	0.134	0.199	DC2L1_MOUSE Cytoplasmic dynein 2 light intermediate chain 1 OS=Mus musculus OX=10090 GN=Dync2li1 PE=1 SV=1
16	Q6AY43	3.84e-06	51.6	351	0.132	0.197	DC2L1_RAT Cytoplasmic dynein 2 light intermediate chain 1 OS=Rattus norvegicus OX=10116 GN=Dync2li1 PE=1 SV=2
17	Q8TCX1	4.42e-06	51.2	351	0.128	0.191	DC2L1_HUMAN Cytoplasmic dynein 2 light intermediate chain 1 OS=Homo sapiens OX=9606 GN=DYNC2LI1 PE=1 SV=1
18	Q381A5	0.002	42.7	418	0.105	0.132	Q381A5_TRYB2 Cytoplasmic dynein 2 light intermediate chain 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.8570 PE=3 SV=1
19	Q382V5	0.004	42.4	620	0.061	0.052	Q382V5_TRYB2 Dynein light intermediate chain OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.4080 PE=3 SV=1
20	O04486	0.063	37.7	217	0.063	0.152	RAA2A_ARATH Ras-related protein RABA2a OS=Arabidopsis thaliana OX=3702 GN=RABA2A PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	31	16.4	AAA ATPase domain
2	PF12775 AAA_7	6.5e+02	11.2	P-loop containing dynein motor region
3	PF00005 ABC_tran	0.22	23.5	ABC transporter
4	PF05783 DLIC	1.3e-252	850.4	Dynein light intermediate chain (DLIC)
5	PF05673 DUF815	1.3e+02	13.1	Protein of unknown function (DUF815)
6	PF00503 G-alpha	1.6e+02	12.9	G-protein alpha subunit
7	PF10662 PduV-EutP	52	15.1	Ethanolamine utilisation - propanediol utilisation
8	PF00071 Ras	1.1e+02	13.8	Ras family
9	PF08477 Roc	3.1	19.5	Ras of Complex, Roc, domain of DAPkinase
10	PF03193 RsgA_GTPase	13	17.1	RsgA GTPase
11	PF02367 TsaE	2.6e+02	13.0	Threonylcarbamoyl adenosine biosynthesis protein TsaE

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000273130

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348965	0.998	Cytoplasmic dynein 1 heavy chain 1
2	9606.ENSP00000380308	0.994	Cytoplasmic dynein 1 intermediate chain 2
3	9606.ENSP00000367841	0.993	Dynein light chain Tctex-type 3
4	9606.ENSP00000320130	0.992	Cytoplasmic dynein 1 intermediate chain 1
5	9606.ENSP00000349351	0.991	Protein bicaudal D homolog 2
6	9606.ENSP00000352572	0.991	Pericentrin
7	9606.ENSP00000356056	0.991	Dynein light chain Tctex-type 1
8	9606.ENSP00000376297	0.966	Dynein light chain 1, cytoplasmic
9	9606.ENSP00000349679	0.962	Dynein light chain roadblock-type 1
10	9606.ENSP00000258198	0.956	Cytoplasmic dynein 1 light intermediate chain 2
11	9606.ENSP00000305699	0.956	Protein Hook homolog 3
12	9606.ENSP00000354791	0.950	Dynactin subunit 1
13	9606.ENSP00000381167	0.941	Cytoplasmic dynein 2 heavy chain 1
14	9606.ENSP00000251775	0.932	Sorting nexin-4
15	9606.ENSP00000302936	0.931	Dynein light chain roadblock-type 2
16	9606.ENSP00000380378	0.927	Platelet-activating factor acetylhydrolase IB subunit alpha
17	9606.ENSP00000477310	0.923	Dynein light chain 2, cytoplasmic
18	9606.ENSP00000360609	0.915	Heat shock protein HSP 90-beta
19	9606.ENSP00000335153	0.910	Heat shock protein HSP 90-alpha
20	9606.ENSP00000482075	0.905	Prostaglandin E synthase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.998	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0051128	0.915	regulation of cellular component organization
GO:0009987	0.913	cellular process
GO:0010564	0.849	regulation of cell cycle process
GO:0071840	0.730	cellular component organization or biogenesis
GO:0016043	0.680	cellular component organization
GO:0033043	0.525	regulation of organelle organization
GO:0006996	0.446	organelle organization
GO:0032886	0.414	regulation of microtubule-based process
GO:0007017	0.402	microtubule-based process
GO:0048518	0.398	positive regulation of biological process
GO:0051179	0.381	localization
GO:0048522	0.378	positive regulation of cellular process
GO:0070507	0.349	regulation of microtubule cytoskeleton organization
GO:0050896	0.348	response to stimulus
GO:0007346	0.300	regulation of mitotic cell cycle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0005813	0.998	centrosome
GO:0012505	0.997	endomembrane system
GO:0031982	0.996	vesicle
GO:0005829	0.996	cytosol
GO:0099080	0.994	supramolecular complex
GO:0016020	0.994	membrane
GO:0032991	0.990	protein-containing complex
GO:0031410	0.989	cytoplasmic vesicle
GO:0005694	0.985	chromosome
GO:0000776	0.980	kinetochore
GO:0031090	0.904	organelle membrane
GO:1902494	0.797	catalytic complex
GO:0005634	0.790	nucleus
GO:0005773	0.720	vacuole
GO:0005875	0.720	microtubule associated complex
GO:0005768	0.710	endosome
GO:0000323	0.695	lytic vacuole
GO:0071944	0.666	cell periphery
GO:0005764	0.656	lysosome
GO:0005886	0.630	plasma membrane
GO:0030286	0.568	dynein complex
GO:0070013	0.506	intracellular organelle lumen
GO:0031981	0.475	nuclear lumen
GO:0005770	0.474	late endosome
GO:0005654	0.457	nucleoplasm
GO:0005868	0.429	cytoplasmic dynein complex
GO:0005615	0.382	extracellular space
GO:0099503	0.314	secretory vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]