StarFunc result for job id Q9Y6H1

User Input

>input (151 residues)
MPRGSRSRTSRMAPPASRAPQMRAAPRPAPVAQPPAAAPPSAVGSSAAAPRQPGLMAQMA
TTAAGVAVGSAVGHTLGHAITGGFSGGSNAEPARPDITYQEPQGTQPAQQQQPCLYEIKQ
FLECAQNQGDIKLCEGFNEVLKQCRLANGLA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y6H1	1.000	1.000	1.406E-20	151	1.000	1.000	Q9Y6H1.pdb.gz	CHCH2_HUMAN Coiled-coil-helix-coiled-coil-helix domain-containing protein 2 OS=Homo sapiens OX=9606 GN=CHCHD2 PE=1 SV=1
2	AFDB:B2RPU8	0.247	0.055	2.408E-13	756	0.821	0.164	B2RPU8.pdb.gz	B2RPU8_MOUSE Coiled-coil-helix-coiled-coil-helix domain containing 2-like OS=Mus musculus OX=10090 GN=Zbed5 PE=1 SV=1
3	AFDB:Q7TNL9	0.350	0.371	1.464E-8	138	0.550	0.601	Q7TNL9.pdb.gz	Q7TNL9_MOUSE Coiled-coil-helix-coiled-coil-helix domain containing 10 OS=Mus musculus OX=10090 GN=Chchd10 PE=1 SV=1
4	AFDB:B5MBW9	0.311	0.314	1.787E-8	149	0.576	0.584	B5MBW9.pdb.gz	B5MBW9_HUMAN Coiled-coil-helix-coiled-coil-helix domain containing 10 OS=Homo sapiens OX=9606 GN=CHCHD10 PE=1 SV=1
5	AFDB:Q9VX77	0.249	0.222	3.039E-8	170	0.536	0.476	Q9VX77.pdb.gz	Q9VX77_DROME Coiled-coil-helix-coiled-coil-helix domain containing 2, isoform A OS=Drosophila melanogaster OX=7227 GN=Chchd2 PE=1 SV=1
6	AFDB:Q09254	0.260	0.256	3.379E-6	154	0.457	0.448	Q09254.pdb.gz	HAR1_CAEEL Hemiasterlin resistant protein 1 OS=Caenorhabditis elegans OX=6239 GN=har-1 PE=4 SV=1
7	AFDB:Q03667	0.243	0.235	9.144E-6	156	0.411	0.397	Q03667.pdb.gz	MIX17_YEAST Mitochondrial intermembrane space cysteine motif-containing protein MIX17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MIX17 PE=1 SV=1
8	AFDB:Q9Z2K1	0.166	0.063	1.836	469	0.179	0.058	Q9Z2K1.pdb.gz	K1C16_MOUSE Keratin, type I cytoskeletal 16 OS=Mus musculus OX=10090 GN=Krt16 PE=1 SV=3
9	PDB:7qsdo	0.250	0.306	2.411	122	0.079	0.098	7qsdo.pdb.gz	Structural basis of mammalian respiratory complex I inhibition by medicinal biguanides.
10	AFDB:O61122	0.207	0.081	2.734	478	0.185	0.059	O61122.pdb.gz	SVKA_DICDI Serine/threonine-protein kinase svkA OS=Dictyostelium discoideum OX=44689 GN=svkA PE=1 SV=1
11	PDB:1ocrH	0.180	0.316	2.942	79	0.086	0.165	1ocrH.pdb.gz	Redox-coupled crystal structural changes in bovine heart cytochrome c oxidase.
12	AFDB:Q6IFV1	0.177	0.070	3.122	485	0.232	0.072	Q6IFV1.pdb.gz	K1C14_RAT Keratin, type I cytoskeletal 14 OS=Rattus norvegicus OX=10116 GN=Krt14 PE=2 SV=1
13	PDB:1u96A	0.183	0.362	4.381	69	0.093	0.203	1u96A.pdb.gz	Yeast cox17 solution structure and Copper(I) binding.
14	PDB:6o3sA	0.214	0.547	6.523	47	0.053	0.170	6o3sA.pdb.gz
15	PDB:3p3kA	0.149	0.142	7.449	159	0.033	0.031	3p3kA.pdb.gz
16	PDB:1f4nA	0.158	0.307	9.713	59	0.013	0.034	1f4nA.pdb.gz	Dramatic structural and thermodynamic consequences of repacking a protein's hydrophobic core.
17	PDB:1rprA	0.135	0.245	9.713	63	0.040	0.095	1rprA.pdb.gz
18	PDB:7cpuLb	0.098	0.130	9.713	99	0.066	0.101	7cpuLb.pdb.gz	A male germ-cell-specific ribosome controls male fertility.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y6H1	1.13e-105	300	151	1.000	1.000	CHCH2_HUMAN Coiled-coil-helix-coiled-coil-helix domain-containing protein 2 OS=Homo sapiens OX=9606 GN=CHCHD2 PE=1 SV=1
2	Q9D1L0	6.14e-74	219	153	0.861	0.850	CHCH2_MOUSE Coiled-coil-helix-coiled-coil-helix domain-containing protein 2 OS=Mus musculus OX=10090 GN=Chchd2 PE=2 SV=1
3	Q8CEW7	2.52e-66	213	583	0.821	0.213	Q8CEW7_MOUSE DUF4371 domain-containing protein OS=Mus musculus OX=10090 GN=Zbed5 PE=2 SV=1
4	B2RPU8	3.50e-65	213	756	0.821	0.164	B2RPU8_MOUSE Coiled-coil-helix-coiled-coil-helix domain containing 2-like OS=Mus musculus OX=10090 GN=Zbed5 PE=1 SV=1
5	D3Z5B1	2.78e-59	183	183	0.603	0.497	D3Z5B1_MOUSE Coiled-coil-helix-coiled-coil-helix domain containing 2-like (Fragment) OS=Mus musculus OX=10090 GN=Zbed5 PE=4 SV=8
6	Q6PBP6	7.13e-43	140	143	0.437	0.462	Q6PBP6_DANRE Coiled-coil-helix-coiled-coil-helix domain-containing 10 OS=Danio rerio OX=7955 GN=chchd2 PE=1 SV=1
7	Q8WYQ3	7.30e-36	122	142	0.550	0.585	CHC10_HUMAN Coiled-coil-helix-coiled-coil-helix domain-containing protein 10, mitochondrial OS=Homo sapiens OX=9606 GN=CHCHD10 PE=1 SV=1
8	B5MBW9	1.56e-35	122	149	0.556	0.564	B5MBW9_HUMAN Coiled-coil-helix-coiled-coil-helix domain containing 10 OS=Homo sapiens OX=9606 GN=CHCHD10 PE=1 SV=1
9	Q8BW15	5.37e-35	120	138	0.391	0.428	Q8BW15_MOUSE Coiled-coil-helix-coiled-coil-helix domain-containing protein 10, mitochondrial OS=Mus musculus OX=10090 GN=Chchd10 PE=2 SV=1
10	Q7TNL9	8.87e-35	120	138	0.391	0.428	Q7TNL9_MOUSE Coiled-coil-helix-coiled-coil-helix domain containing 10 OS=Mus musculus OX=10090 GN=Chchd10 PE=1 SV=1
11	Q2V056	9.26e-32	110	98	0.391	0.602	Q2V056_MOUSE CHCH domain-containing protein OS=Mus musculus OX=10090 GN=Chchd10 PE=2 SV=1
12	X2JFJ0	2.49e-28	103	122	0.384	0.475	X2JFJ0_DROME Coiled-coil-helix-coiled-coil-helix domain containing 2, isoform B OS=Drosophila melanogaster OX=7227 GN=Chchd2 PE=1 SV=1
13	Q9VX77	3.32e-28	104	170	0.384	0.341	Q9VX77_DROME Coiled-coil-helix-coiled-coil-helix domain containing 2, isoform A OS=Drosophila melanogaster OX=7227 GN=Chchd2 PE=1 SV=1
14	Q09254	6.22e-25	95.5	154	0.417	0.409	HAR1_CAEEL Hemiasterlin resistant protein 1 OS=Caenorhabditis elegans OX=6239 GN=har-1 PE=4 SV=1
15	Q03667	3.06e-19	80.9	156	0.404	0.391	MIX17_YEAST Mitochondrial intermembrane space cysteine motif-containing protein MIX17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MIX17 PE=1 SV=1
16	Q59WV9	7.75e-14	66.6	151	0.272	0.272	Q59WV9_CANAL Mic17p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C600920WA PE=4 SV=1
17	Q10307	3.00e-13	65.5	172	0.377	0.331	YD52_SCHPO Uncharacterized protein C6C3.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6C3.02c PE=4 SV=1
18	O75962	0.022	36.6	3097	0.159	0.008	TRIO_HUMAN Triple functional domain protein OS=Homo sapiens OX=9606 GN=TRIO PE=1 SV=2
19	D3ZT52	0.28	33.5	1652	0.152	0.014	D3ZT52_RAT Polybromo 1 OS=Rattus norvegicus OX=10116 GN=Pbrm1 PE=1 SV=3
20	Q8NA72	0.30	33.1	575	0.119	0.031	POC5_HUMAN Centrosomal protein POC5 OS=Homo sapiens OX=9606 GN=POC5 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06747 CHCH	0.0012	30.2	CHCH domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378812

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000418428	0.994	Coiled-coil-helix-coiled-coil-helix domain-containing protein 10, mitochondrial
2	9606.ENSP00000295767	0.972	Mitochondrial intermembrane space import and assembly protein 40
3	9606.ENSP00000262570	0.965	MICOS complex subunit MIC19
4	9606.ENSP00000302564	0.960	Bcl-2-like protein 1
5	9606.ENSP00000261070	0.947	Cytochrome c oxidase copper chaperone
6	9606.ENSP00000215570	0.936	Mitochondrial import inner membrane translocase subunit Tim13
7	9606.ENSP00000355572	0.935	Cytochrome c oxidase assembly factor 6 homolog
8	9606.ENSP00000342015	0.934	Cytochrome c oxidase assembly protein COX19
9	9606.ENSP00000248114	0.931	FAD-linked sulfhydryl oxidase ALR
10	9606.ENSP00000361993	0.930	Mitochondrial import inner membrane translocase subunit Tim8 A
11	9606.ENSP00000306425	0.925	Mitochondrial coiled-coil-helix-coiled-coil-helix domain containing proteins
12	9606.ENSP00000438455	0.918	Mitochondrial import inner membrane translocase subunit Tim8 B
13	9606.ENSP00000219400	0.909	COX assembly mitochondrial protein 2 homolog
14	9606.ENSP00000325655	0.902	Mitochondrial coiled-coil-helix-coiled-coil-helix domain containing proteins
15	9606.ENSP00000347919	0.900	Cytochrome c oxidase assembly factor 4 homolog, mitochondrial
16	9606.ENSP00000358496	0.900	Cx9C motif-containing protein 4
17	9606.ENSP00000290913	0.896	MICOS complex subunit MIC25
18	9606.ENSP00000317780	0.836	Cytochrome c oxidase subunit 5A, mitochondrial
19	9606.ENSP00000284727	0.833	ATP synthase F(0) complex subunit C3, mitochondrial
20	9606.ENSP00000266087	0.815	F-box only protein 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003677	1.000	DNA binding
GO:0008134	0.996	transcription factor binding
GO:0043565	0.993	sequence-specific DNA binding
GO:0140297	0.988	DNA-binding transcription factor binding
GO:0003824	0.300	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0065007	0.960	biological regulation
GO:0050789	0.947	regulation of biological process
GO:0050794	0.934	regulation of cellular process
GO:0050896	0.892	response to stimulus
GO:0048518	0.884	positive regulation of biological process
GO:0048522	0.874	positive regulation of cellular process
GO:0051716	0.862	cellular response to stimulus
GO:0031323	0.835	regulation of cellular metabolic process
GO:0060255	0.827	regulation of macromolecule metabolic process
GO:0010604	0.769	positive regulation of macromolecule metabolic process
GO:0043467	0.760	regulation of generation of precursor metabolites and energy
GO:0006950	0.731	response to stress
GO:0070887	0.715	cellular response to chemical stimulus
GO:0080090	0.667	regulation of primary metabolic process
GO:0051171	0.667	regulation of nitrogen compound metabolic process
GO:0031325	0.654	positive regulation of cellular metabolic process
GO:0071840	0.609	cellular component organization or biogenesis
GO:0016043	0.581	cellular component organization
GO:0009889	0.570	regulation of biosynthetic process
GO:0006979	0.560	response to oxidative stress
GO:0048583	0.559	regulation of response to stimulus
GO:0033554	0.495	cellular response to stress
GO:0010468	0.441	regulation of gene expression
GO:0031326	0.394	regulation of cellular biosynthetic process
GO:0008152	0.393	metabolic process
GO:0006996	0.373	organelle organization
GO:0007005	0.342	mitochondrion organization
GO:0009891	0.331	positive regulation of biosynthetic process
GO:0044237	0.315	cellular metabolic process
GO:0034599	0.310	cellular response to oxidative stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.999	intracellular organelle lumen
GO:0005634	0.982	nucleus
GO:0005740	0.967	mitochondrial envelope
GO:0032991	0.893	protein-containing complex
GO:0016020	0.884	membrane
GO:0031090	0.848	organelle membrane
GO:0005758	0.528	mitochondrial intermembrane space
GO:0031981	0.398	nuclear lumen
GO:0031966	0.362	mitochondrial membrane
GO:0005743	0.348	mitochondrial inner membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]