StarFunc result for job id Q9Y6H3

User Input

>input (246 residues)
MAGAPDERRRGPAAGEQLQQQHVSCQVFPERLAQGNPQQGFFSSFFTSNQKCQLRLLKTL
ETNPYVKLLLDAMKHSGCAVNKDRHFSCEDCNGNVSGGFDASTSQIVLCQNNIHNQAHMN
RVVTHELIHAFDHCRAHVDWFTNIRHLACSEVRAANLSGDCSLVNEIFRLHFGLKQHHQT
CVRDRATLSILAVRNISKEVAKKAVDEVFESCFNDHEPFGRIPHNKTYARYAHRDFENRD
RYYSNI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y6H3	1.000	1.000	2.902E-38	246	1.000	1.000	Q9Y6H3.pdb.gz	ATP23_HUMAN Mitochondrial inner membrane protease ATP23 homolog OS=Homo sapiens OX=9606 GN=ATP23 PE=1 SV=3
2	AFDB:Q9SRP6	0.664	0.835	5.635E-13	194	0.301	0.381	Q9SRP6.pdb.gz	ATP23_ARATH Mitochondrial inner membrane protease ATP23 OS=Arabidopsis thaliana OX=3702 GN=ATP23 PE=1 SV=1
3	AFDB:P53722	0.663	0.716	1.354E-11	227	0.276	0.300	P53722.pdb.gz	ATP23_YEAST Mitochondrial inner membrane protease ATP23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATP23 PE=1 SV=2
4	AFDB:Q38AZ4	0.641	0.641	8.205E-9	246	0.228	0.228	Q38AZ4.pdb.gz	Q38AZ4_TRYB2 Mitochondrial inner membrane protease ATP23 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.0750 PE=3 SV=1
5	PDB:4b2te	0.175	0.132	2.972E-1	359	0.089	0.061	4b2te.pdb.gz
6	AFDB:A2QYG9	0.126	0.106	5.569E-1	308	0.146	0.117	A2QYG9.pdb.gz	A2QYG9_ASPNC Contig An12c0040, genomic contig OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An12g01190 PE=3 SV=1
7	AFDB:P40522	0.174	0.101	7.404E-1	640	0.118	0.045	P40522.pdb.gz	VHR1_YEAST Transcription factor VHR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VHR1 PE=1 SV=1
8	AFDB:Q6NKU9	0.195	0.220	7.404E-1	214	0.085	0.098	Q6NKU9.pdb.gz	TI223_ARATH Mitochondrial import inner membrane translocase subunit TIM22-3 OS=Arabidopsis thaliana OX=3702 GN=TIM22-3 PE=2 SV=1
9	PDB:5jxdA	0.163	0.195	7.678E-1	186	0.110	0.145	5jxdA.pdb.gz	The Tnfaip8-PE complex is a novel upstream effector in the anti-autophagic action of insulin
10	AFDB:Q90YI0	0.147	0.150	7.763E-1	241	0.134	0.137	Q90YI0.pdb.gz	IL6_CHICK Interleukin-6 OS=Gallus gallus OX=9031 GN=IL6 PE=2 SV=1
11	AFDB:O65359	0.116	0.098	8.536E-1	322	0.102	0.078	O65359.pdb.gz	SYP41_ARATH Tlg2p-like protein a OS=Arabidopsis thaliana OX=3702 GN=SYP41 PE=1 SV=1
12	AFDB:Q6NXT1	0.158	0.141	8.951E-1	300	0.102	0.083	Q6NXT1.pdb.gz	ANR54_HUMAN Ankyrin repeat domain-containing protein 54 OS=Homo sapiens OX=9606 GN=ANKRD54 PE=1 SV=2
13	PDB:3kq4A	0.132	0.093	1.423	385	0.102	0.065	3kq4A.pdb.gz	Structural basis for receptor recognition of vitamin-B(12)-intrinsic factor complexes.
14	PDB:3t33A	0.186	0.133	1.720	407	0.126	0.076	3t33A.pdb.gz	Crystal Structure of Arabidopsis GCR2 Identifies a Novel Clade of Lantibiotic Cyclase-Like Proteins
15	PDB:3zhwA	0.133	0.185	1.804	154	0.085	0.136	3zhwA.pdb.gz	X-Ray Crystallographic Structural Characteristics of Arabidopsis Hemoglobin I and Their Functional Implications
16	PDB:6rkoA	0.119	0.073	1.804	444	0.081	0.045	6rkoA.pdb.gz	Active site rearrangement and structural divergence in prokaryotic respiratory oxidases.
17	PDB:7oseA	0.149	0.087	1.984	503	0.077	0.038	7oseA.pdb.gz	Structure of Escherichia coli cytochrome bd-II type oxidase with bound aurachin D.
18	PDB:6krdD	0.172	0.113	2.080	429	0.065	0.037	6krdD.pdb.gz
19	PDB:6u3eA	0.206	0.155	3.040	397	0.118	0.073	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
20	PDB:5lolA	0.166	0.182	3.188	207	0.098	0.116	5lolA.pdb.gz	Arabidopsis thaliana dehydroascorbate reductase 2: Conformational flexibility during catalysis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y6H3	0.0	515	246	1.000	1.000	ATP23_HUMAN Mitochondrial inner membrane protease ATP23 homolog OS=Homo sapiens OX=9606 GN=ATP23 PE=1 SV=3
2	Q8N4L5	7.40e-38	130	112	0.248	0.545	Q8N4L5_HUMAN XRCC6BP1 protein OS=Homo sapiens OX=9606 GN=XRCC6BP1 PE=1 SV=1
3	Q9SRP6	2.73e-36	129	194	0.293	0.371	ATP23_ARATH Mitochondrial inner membrane protease ATP23 OS=Arabidopsis thaliana OX=3702 GN=ATP23 PE=1 SV=1
4	P53722	7.88e-31	115	227	0.268	0.291	ATP23_YEAST Mitochondrial inner membrane protease ATP23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATP23 PE=1 SV=2
5	Q38AZ4	8.51e-16	76.3	246	0.167	0.167	Q38AZ4_TRYB2 Mitochondrial inner membrane protease ATP23 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.0750 PE=3 SV=1
6	D4A523	0.71	33.5	1035	0.093	0.022	NLRP3_RAT NACHT, LRR and PYD domains-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Nlrp3 PE=3 SV=2
7	A0A0B4KHH8	1.4	32.7	753	0.077	0.025	A0A0B4KHH8_DROME Syncrip, isoform K OS=Drosophila melanogaster OX=7227 GN=Syp PE=1 SV=1
8	A0A0B4KHI4	1.4	32.7	761	0.077	0.025	A0A0B4KHI4_DROME Syncrip, isoform Q OS=Drosophila melanogaster OX=7227 GN=Syp PE=1 SV=1
9	A0A0B4KHT5	1.4	32.7	761	0.077	0.025	A0A0B4KHT5_DROME Syncrip, isoform J OS=Drosophila melanogaster OX=7227 GN=Syp PE=1 SV=1
10	Q2MGN0	3.0	31.6	400	0.057	0.035	Q2MGN0_DROME FI01014p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG3065 PE=1 SV=1
11	H7C4C2	4.8	30.8	580	0.077	0.033	H7C4C2_HUMAN ALF transcription elongation factor 3 (Fragment) OS=Homo sapiens OX=9606 GN=AFF3 PE=1 SV=2
12	A0A0B4KH24	5.2	30.8	611	0.077	0.031	A0A0B4KH24_DROME Syncrip, isoform O OS=Drosophila melanogaster OX=7227 GN=Syp PE=1 SV=1
13	A0A0B4KGK8	5.4	30.8	569	0.077	0.033	A0A0B4KGK8_DROME Syncrip, isoform R OS=Drosophila melanogaster OX=7227 GN=Syp PE=1 SV=1
14	A0A0B4KH21	5.4	30.8	603	0.077	0.032	A0A0B4KH21_DROME Syncrip, isoform I OS=Drosophila melanogaster OX=7227 GN=Syp PE=1 SV=1
15	A8JR54	5.4	30.8	534	0.077	0.036	A8JR54_DROME Syncrip, isoform H OS=Drosophila melanogaster OX=7227 GN=Syp PE=1 SV=1
16	A4V364	5.7	30.8	529	0.077	0.036	A4V364_DROME Syncrip, isoform F OS=Drosophila melanogaster OX=7227 GN=Syp PE=1 SV=1
17	Q8IN48	5.7	30.8	571	0.077	0.033	Q8IN48_DROME Syncrip, isoform E OS=Drosophila melanogaster OX=7227 GN=Syp PE=1 SV=1
18	Q8IN47	5.8	30.8	563	0.077	0.034	Q8IN47_DROME Syncrip, isoform A OS=Drosophila melanogaster OX=7227 GN=Syp PE=1 SV=2
19	Q7KSA0	6.0	30.8	711	0.077	0.027	Q7KSA0_DROME Syncrip, isoform B OS=Drosophila melanogaster OX=7227 GN=Syp PE=1 SV=1
20	Q95TW4	6.0	30.4	529	0.077	0.036	Q95TW4_DROME GH28335p OS=Drosophila melanogaster OX=7227 GN=Syp PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09768 Peptidase_M76	4.8e-53	190.9	Peptidase M76 family
2	PF06167 Peptidase_M90	1.6e+02	13.3	Glucose-regulated metallo-peptidase M90

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000300145

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000352257	0.956	X-ray repair cross-complementing protein 6
2	9606.ENSP00000295767	0.934	Mitochondrial intermembrane space import and assembly protein 40
3	9606.ENSP00000265038	0.924	DNA excision repair protein ERCC-8
4	9606.ENSP00000347978	0.924	DNA repair protein complementing XP-G cells
5	9606.ENSP00000310520	0.919	DNA repair endonuclease XPF
6	9606.ENSP00000421491	0.917	DNA repair protein XRCC4
7	9606.ENSP00000313420	0.915	DNA-dependent protein kinase catalytic subunit
8	9606.ENSP00000375978	0.912	X-ray repair cross-complementing protein 5
9	9606.ENSP00000350708	0.910	UV excision repair protein RAD23 homolog B
10	9606.ENSP00000367527	0.910	Protein artemis
11	9606.ENSP00000484288	0.910	DNA ligase 4
12	9606.ENSP00000013807	0.909	DNA excision repair protein ERCC-1
13	9606.ENSP00000233146	0.907	DNA mismatch repair protein Msh2
14	9606.ENSP00000349313	0.907	Non-homologous end-joining factor 1
15	9606.ENSP00000278616	0.903	Serine-protein kinase ATM
16	9606.ENSP00000234420	0.902	DNA mismatch repair protein Msh6
17	9606.ENSP00000262241	0.900	REST corepressor 1
18	9606.ENSP00000285021	0.900	DNA repair protein complementing XP-C cells
19	9606.ENSP00000310008	0.900	ATPase SWSAP1
20	9606.ENSP00000359300	0.900	Centrin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0004677	0.914	DNA-dependent protein kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006281	0.992	DNA repair
GO:0006302	0.968	double-strand break repair
GO:0006303	0.964	double-strand break repair via nonhomologous end joining
GO:0065007	0.425	biological regulation
GO:0050789	0.415	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0016020	0.999	membrane
GO:0005829	0.998	cytosol
GO:0071944	0.989	cell periphery
GO:0005886	0.983	plasma membrane
GO:0030054	0.955	cell junction
GO:0070013	0.954	intracellular organelle lumen
GO:0005634	0.746	nucleus
GO:0031981	0.446	nuclear lumen
GO:0032991	0.393	protein-containing complex
GO:0005739	0.343	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]