StarFunc result for job id Q9Y6H6

User Input

>input (103 residues)
METTNGTETWYESLHAVLKALNATLHSNLLCRPGPGLGPDNQTEERRASLPGRDDNSYMY
ILFVMFLFAVTVGSLILGYTRSRKVDKRSDPYHVYIKNRVSMI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:2ndjA	0.257	0.257	8.013E-12	103	1.000	1.000	2ndjA.pdb.gz
2	AFDB:Q9D771	0.469	0.187	9.728E-1	350	0.184	0.054	Q9D771.pdb.gz	PACC1_MOUSE Proton-activated chloride channel OS=Mus musculus OX=10090 GN=Pacc1 PE=1 SV=1
3	PDB:7qooH	0.360	0.202	5.554	210	0.126	0.062	7qooH.pdb.gz	Structure of the human inner kinetochore CCAN complex and its significance for human centromere organization.
4	AFDB:P26715	0.272	0.134	5.842	233	0.117	0.052	P26715.pdb.gz	NKG2A_HUMAN NKG2-A/NKG2-B type II integral membrane protein OS=Homo sapiens OX=9606 GN=KLRC1 PE=1 SV=2
5	AFDB:Q23677	0.285	0.096	5.842	498	0.136	0.028	Q23677.pdb.gz	Q23677_CAEEL Protein kinase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=old-2 PE=4 SV=1
6	PDB:2k21A	0.294	0.243	5.985	129	0.184	0.147	2k21A.pdb.gz
7	PDB:4gwqB	0.282	0.079	5.985	492	0.097	0.020	4gwqB.pdb.gz	Structure of the Mediator Head module bound to the carboxy-terminal domain of RNA polymerase II.
8	AFDB:D2DHG1	0.322	0.059	6.295	659	0.136	0.021	D2DHG1.pdb.gz	D2DHG1_DANRE Prospero homeobox 3 OS=Danio rerio OX=7955 GN=prox1b PE=2 SV=1
9	AFDB:Q9W0C1	0.314	0.181	6.295	183	0.097	0.055	Q9W0C1.pdb.gz	NSYB_DROME Neuronal synaptobrevin OS=Drosophila melanogaster OX=7227 GN=nSyb PE=1 SV=1
10	PDB:7cgpJ	0.264	0.305	6.449	83	0.107	0.133	7cgpJ.pdb.gz
11	PDB:7qsmg	0.314	0.320	6.449	101	0.107	0.109	7qsmg.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
12	AFDB:A0A024R648	0.257	0.296	6.784	89	0.078	0.090	A0A024R648.pdb.gz
13	AFDB:O48849	0.321	0.052	6.784	890	0.078	0.009	O48849.pdb.gz	RLP23_ARATH Receptor like protein 23 OS=Arabidopsis thaliana OX=3702 GN=RLP23 PE=1 SV=1
14	AFDB:E9QFM9	0.261	0.063	7.310	583	0.117	0.021	E9QFM9.pdb.gz
15	AFDB:Q9I115	0.212	0.098	7.310	328	0.126	0.040	Q9I115.pdb.gz	Q9I115_PSEAE Anti-sigma factor FoxR OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=foxR PE=4 SV=1
16	PDB:5nzuD	0.243	0.084	7.488	427	0.068	0.016	5nzuD.pdb.gz
17	PDB:6c0f8	0.310	0.325	7.488	98	0.097	0.102	6c0f8.pdb.gz	Modular assembly of the nucleolar pre-60S ribosomal subunit.
18	AFDB:A0A2R8Q310	0.256	0.044	7.877	875	0.117	0.014	A0A2R8Q310.pdb.gz
19	PDB:7o37i	0.281	0.365	8.068	72	0.087	0.125	7o37i.pdb.gz	Structure and assembly of the mammalian mitochondrial supercomplex CIII 2 CIV.
20	PDB:2bskC	0.260	0.325	8.694	79	0.078	0.101	2bskC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6IAE6	2.72e-74	216	103	1.000	1.000	Q6IAE6_HUMAN KCNE3 protein OS=Homo sapiens OX=9606 GN=KCNE3 PE=2 SV=1
2	Q9Y6H6	2.72e-74	216	103	1.000	1.000	KCNE3_HUMAN Potassium voltage-gated channel subfamily E member 3 OS=Homo sapiens OX=9606 GN=KCNE3 PE=1 SV=1
3	Q2N1I1	2.24e-71	209	99	0.961	1.000	Q2N1I1_HUMAN Cardiac voltage-gated potassium channel accessory subunit isoform 3a (Fragment) OS=Homo sapiens OX=9606 GN=KCNE3 PE=1 SV=1
4	Q9WTW2	1.14e-68	202	103	0.932	0.932	KCNE3_MOUSE Potassium voltage-gated channel subfamily E member 3 OS=Mus musculus OX=10090 GN=Kcne3 PE=3 SV=1
5	Q9JJV7	9.20e-60	180	107	0.913	0.879	KCNE3_RAT Potassium voltage-gated channel subfamily E member 3 OS=Rattus norvegicus OX=10116 GN=Kcne3 PE=1 SV=1
6	E9PJV9	2.07e-33	112	52	0.505	1.000	E9PJV9_HUMAN Potassium voltage-gated channel subfamily E regulatory subunit 3 (Fragment) OS=Homo sapiens OX=9606 GN=KCNE3 PE=1 SV=8
7	E9PN03	5.18e-31	105	49	0.476	1.000	E9PN03_HUMAN Potassium voltage-gated channel subfamily E regulatory subunit 3 (Fragment) OS=Homo sapiens OX=9606 GN=KCNE3 PE=1 SV=8
8	Q9UJ90	5.58e-07	47.0	142	0.262	0.190	KCNE5_HUMAN Potassium voltage-gated channel subfamily E regulatory beta subunit 5 OS=Homo sapiens OX=9606 GN=KCNE5 PE=1 SV=1
9	P15383	9.63e-05	40.8	130	0.233	0.185	KCNE1_RAT Potassium voltage-gated channel subfamily E member 1 OS=Rattus norvegicus OX=10116 GN=Kcne1 PE=1 SV=1
10	P23299	2.83e-04	39.3	129	0.194	0.155	KCNE1_MOUSE Potassium voltage-gated channel subfamily E member 1 OS=Mus musculus OX=10090 GN=Kcne1 PE=1 SV=1
11	Q6FHJ6	3.75e-04	39.3	129	0.165	0.132	Q6FHJ6_HUMAN Potassium voltage-gated channel subfamily E member 1 (Fragment) OS=Homo sapiens OX=9606 GN=KCNE1 PE=1 SV=1
12	P15382	0.002	37.4	129	0.136	0.109	KCNE1_HUMAN Potassium voltage-gated channel subfamily E member 1 OS=Homo sapiens OX=9606 GN=KCNE1 PE=1 SV=1
13	P63161	0.004	36.2	123	0.214	0.179	KCNE2_RAT Potassium voltage-gated channel subfamily E member 2 OS=Rattus norvegicus OX=10116 GN=Kcne2 PE=1 SV=1
14	Q71FD8	0.004	36.6	170	0.165	0.100	Q71FD8_RAT Potassium voltage-gated channel subfamily E regulatory subunit 4 OS=Rattus norvegicus OX=10116 GN=Kcne4 PE=3 SV=1
15	Q0ZA03	0.040	34.3	1124	0.214	0.020	Q0ZA03_WHEAT non-specific serine/threonine protein kinase OS=Triticum aestivum OX=4565 GN=Bri1 PE=2 SV=1
16	Q9Y6J6	0.042	33.5	123	0.175	0.146	KCNE2_HUMAN Potassium voltage-gated channel subfamily E member 2 OS=Homo sapiens OX=9606 GN=KCNE2 PE=1 SV=1
17	Q8WWG9	0.19	32.3	221	0.126	0.059	KCNE4_HUMAN Potassium voltage-gated channel subfamily E member 4 OS=Homo sapiens OX=9606 GN=KCNE4 PE=1 SV=4
18	Q9D808	0.22	31.6	123	0.194	0.163	KCNE2_MOUSE Potassium voltage-gated channel subfamily E member 2 OS=Mus musculus OX=10090 GN=Kcne2 PE=1 SV=2
19	Q54MI5	1.2	30.0	359	0.136	0.039	Q54MI5_DICDI SMP-LTD domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0285921 PE=4 SV=1
20	Q18031	2.5	29.3	1041	0.233	0.023	Q18031_CAEEL proton-translocating NAD(P)(+) transhydrogenase OS=Caenorhabditis elegans OX=6239 GN=nnt-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02060 ISK_Channel	0.00024	32.2	Slow voltage-gated potassium channel

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010365125.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010380371.1	0.986	Belongs to the potassium channel family.
2	61622.XP_010370748.1	0.898	Potassium calcium-activated channel subfamily N member 4
3	61622.XP_010352842.1	0.856	Potassium voltage-gated channel subfamily J member 13
4	61622.XP_010388028.1	0.814	Belongs to the two pore domain potassium channel (TC 1.A.1.8) family
5	61622.XP_010357370.1	0.751	Potassium voltage-gated channel subfamily D member 3 isoform X1
6	61622.XP_010378234.1	0.729	Potassium voltage-gated channel subfamily H member 2
7	61622.XP_010384560.1	0.720	Belongs to the potassium channel family.
8	61622.XP_010357167.1	0.715	Potassium voltage-gated channel subfamily E member 1 isoform X1
9	61622.XP_010353737.1	0.709	Potassium voltage-gated channel subfamily E regulatory subunit 4
10	61622.XP_010357158.1	0.709	Potassium voltage-gated channel subfamily E member 2
11	61622.XP_010352536.1	0.708	Potassium voltage-gated channel subfamily KQT member 4
12	61622.XP_010370505.1	0.700	Potassium voltage-gated channel subfamily Q member 5
13	61622.XP_010376958.1	0.689	Potassium voltage-gated channel subfamily E regulatory subunit 5
14	61622.XP_010363591.1	0.667	Potassium voltage-gated channel subfamily KQT member 2
15	61622.XP_010351839.1	0.651	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 237 ESTs, 7 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
16	61622.XP_010351857.1	0.651	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 ESTs, and 86% coverage of the annotated genomic feature by RNAseq alignments
17	61622.XP_010352763.1	0.649	Glycerol-3-phosphate dehydrogenase 1-like protein isoform X1
18	61622.XP_010387409.1	0.638	Belongs to the G-protein coupled receptor 1 family.
19	61622.XP_010354749.1	0.625	Sodium voltage-gated channel beta subunit 3
20	61622.XP_010365113.1	0.622	X-ray radiation resistance-associated protein 1 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0015459	1.000	potassium channel regulator activity
GO:0044325	0.762	transmembrane transporter binding
GO:0005215	0.747	transporter activity
GO:0015318	0.735	inorganic molecular entity transmembrane transporter activity
GO:0015075	0.730	monoatomic ion transmembrane transporter activity
GO:0022890	0.713	inorganic cation transmembrane transporter activity
GO:1901702	0.708	salt transmembrane transporter activity
GO:0008324	0.706	monoatomic cation transmembrane transporter activity
GO:0046873	0.692	metal ion transmembrane transporter activity
GO:0015267	0.666	channel activity
GO:0005216	0.653	monoatomic ion channel activity
GO:0005261	0.634	monoatomic cation channel activity
GO:0015079	0.613	potassium ion transmembrane transporter activity
GO:0005267	0.604	potassium channel activity
GO:0022839	0.521	monoatomic ion gated channel activity
GO:0005249	0.485	voltage-gated potassium channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0030001	0.964	metal ion transport
GO:0009987	0.955	cellular process
GO:0043269	0.948	regulation of monoatomic ion transport
GO:0006813	0.948	potassium ion transport
GO:0010959	0.941	regulation of metal ion transport
GO:0034765	0.940	regulation of monoatomic ion transmembrane transport
GO:0098660	0.933	inorganic ion transmembrane transport
GO:1904062	0.930	regulation of monoatomic cation transmembrane transport
GO:1903522	0.925	regulation of blood circulation
GO:0032412	0.922	regulation of monoatomic ion transmembrane transporter activity
GO:0008016	0.920	regulation of heart contraction
GO:0065008	0.902	regulation of biological quality
GO:0061337	0.897	cardiac conduction
GO:0042391	0.877	regulation of membrane potential
GO:0043266	0.862	regulation of potassium ion transport
GO:0048519	0.857	negative regulation of biological process
GO:1901379	0.839	regulation of potassium ion transmembrane transport
GO:2001257	0.839	regulation of cation channel activity
GO:0048522	0.837	positive regulation of cellular process
GO:0048523	0.833	negative regulation of cellular process
GO:0051051	0.818	negative regulation of transport
GO:0098662	0.806	inorganic cation transmembrane transport
GO:0098655	0.805	monoatomic cation transmembrane transport
GO:0043271	0.797	negative regulation of monoatomic ion transport
GO:1904063	0.789	negative regulation of cation transmembrane transport
GO:0002027	0.776	regulation of heart rate
GO:0043267	0.766	negative regulation of potassium ion transport
GO:1901016	0.752	regulation of potassium ion transmembrane transporter activity
GO:2001258	0.715	negative regulation of cation channel activity
GO:0071805	0.663	potassium ion transmembrane transport
GO:0043270	0.574	positive regulation of monoatomic ion transport
GO:0042592	0.555	homeostatic process
GO:0032501	0.503	multicellular organismal process
GO:0048878	0.418	chemical homeostasis
GO:0098900	0.335	regulation of action potential
GO:0006814	0.327	sodium ion transport
GO:0006936	0.318	muscle contraction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0032991	0.986	protein-containing complex
GO:0098796	0.962	membrane protein complex
GO:1990351	0.951	transporter complex
GO:1902495	0.933	transmembrane transporter complex
GO:0098797	0.927	plasma membrane protein complex
GO:0034703	0.919	cation channel complex
GO:0034705	0.856	potassium channel complex
GO:0008076	0.854	voltage-gated potassium channel complex
GO:0005622	0.712	intracellular anatomical structure
GO:0005737	0.412	cytoplasm
GO:0031982	0.386	vesicle
GO:0045121	0.377	membrane raft
GO:0032809	0.370	neuronal cell body membrane
GO:0043204	0.365	perikaryon
GO:0030425	0.349	dendrite

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29463	0.613	K(+)(in) = K(+)(out)

[back to server]