StarFunc result for job id Q9Y6I3

User Input

>input (576 residues)
MSTSSLRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMI
WKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVSQQCKENMYAVQTLKDFQYVDRDGKDQG
VNVREKAKQLVALLRDEDRLREERAHALKTKEKLAQTATASSAAVGSGPPPEAEQAWPQS
SGEEELQLQLALAMSKEEADQPPSCGPEDDAQLQLALSLSREEHDKEERIRRGDDLRLQM
AIEESKRETGGKEESSLMDLADVFTAPAPAPTTDPWGGPAPMAAAVPTAAPTSDPWGGPP
VPPAADPWGGPAPTPASGDPWRPAAPAGPSVDPWGGTPAPAAGEGPTPDPWGSSDGGVPV
SGPSASDPWTPAPAFSDPWGGSPAKPSTNGTTAAGGFDTEPDEFSDFDRLRTALPTSGSS
AGELELLAGEVPARSPGAFDMSGVRGSLAEAVGSPPPAATPTPTPPTRKTPESFLGPNAA
LVDLDSLVSRPGPTPPGAKASNPFLPGGGPATGPSVTNPFQPAPPATLTLNQLRLSPVPP
VPGAPPTYISPLGGGPGLPPMMPPGPPAPNTNPFLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y6I3	1.000	1.000	6.163E-79	576	1.000	1.000	Q9Y6I3.pdb.gz	EPN1_HUMAN Epsin-1 OS=Homo sapiens OX=9606 GN=EPN1 PE=1 SV=2
2	AFDB:B2MVI1	0.282	0.256	1.428E-38	638	0.575	0.519	B2MVI1.pdb.gz	B2MVI1_LAMFL Epsin 1 (Fragment) OS=Lampetra fluviatilis OX=7748 PE=2 SV=1
3	AFDB:Q8CHU3	0.291	0.283	4.891E-36	595	0.512	0.496	Q8CHU3.pdb.gz	EPN2_MOUSE Epsin-2 OS=Mus musculus OX=10090 GN=Epn2 PE=1 SV=1
4	AFDB:Q9H201	0.291	0.266	2.483E-34	632	0.486	0.443	Q9H201.pdb.gz	EPN3_HUMAN Epsin-3 OS=Homo sapiens OX=9606 GN=EPN3 PE=2 SV=1
5	AFDB:Q91W69	0.291	0.264	1.502E-33	636	0.497	0.450	Q91W69.pdb.gz	EPN3_MOUSE Epsin-3 OS=Mus musculus OX=10090 GN=Epn3 PE=1 SV=1
6	AFDB:Q9VS85	0.274	0.190	1.617E-30	831	0.424	0.294	Q9VS85.pdb.gz	Q9VS85_DROME FI19443p1 OS=Drosophila melanogaster OX=7227 GN=lqf PE=1 SV=3
7	AFDB:M9PEF2	0.280	0.206	1.079E-28	791	0.424	0.308	M9PEF2.pdb.gz	M9PEF2_DROME Liquid facets, isoform J OS=Drosophila melanogaster OX=7227 GN=lqf PE=1 SV=1
8	AFDB:Q9BI71	0.285	0.343	5.850E-28	469	0.352	0.433	Q9BI71.pdb.gz	Q9BI71_CAEEL ENTH domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=epn-1 PE=1 SV=1
9	AFDB:A0A0S2Z5H3	0.275	0.247	3.016E-18	643	0.283	0.253	A0A0S2Z5H3.pdb.gz	A0A0S2Z5H3_HUMAN Clathrin interactor 1 isoform 2 (Fragment) OS=Homo sapiens OX=9606 GN=CLINT1 PE=2 SV=1
10	AFDB:Q8IYW4	0.284	0.270	1.001E-17	607	0.260	0.247	Q8IYW4.pdb.gz	ENTD1_HUMAN ENTH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ENTHD1 PE=1 SV=1
11	PDB:7oo3c	0.173	0.611	9.131E-2	141	0.028	0.113	7oo3c.pdb.gz	Structural basis of human transcription-DNA repair coupling.
12	PDB:1qgkA	0.167	0.113	2.871E-1	876	0.035	0.023	1qgkA.pdb.gz
13	PDB:4r0zA	0.103	0.106	4.205E-1	557	0.031	0.032	4r0zA.pdb.gz
14	PDB:7mqzA	0.093	0.186	5.524E-1	209	0.033	0.091	7mqzA.pdb.gz
15	PDB:7q83D	0.080	0.239	5.833E-1	156	0.028	0.103	7q83D.pdb.gz
16	PDB:6bcuW	0.137	0.079	6.506E-1	1052	0.028	0.015	6bcuW.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.
17	PDB:7jv7C	0.106	0.184	6.870E-1	250	0.040	0.092	7jv7C.pdb.gz
18	PDB:4ct7B	0.150	0.283	7.662E-1	269	0.024	0.052	4ct7B.pdb.gz	Structural and Biochemical Insights to the Role of the Ccr4-not Complex and Ddx6 ATPase in Microrna Repression.
19	PDB:7cm7A	0.133	0.125	7.662E-1	620	0.035	0.032	7cm7A.pdb.gz	The NAD + -mediated self-inhibition mechanism of pro-neurodegenerative SARM1.
20	PDB:4tnmA	0.114	0.155	8.092E-1	407	0.031	0.044	4tnmA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O88339	0.0	938	575	0.946	0.948	EPN1_RAT Epsin-1 OS=Rattus norvegicus OX=10116 GN=Epn1 PE=1 SV=1
2	Q80VP1	0.0	956	575	0.948	0.950	EPN1_MOUSE Epsin-1 OS=Mus musculus OX=10090 GN=Epn1 PE=1 SV=3
3	Q9Y6I3	0.0	1139	576	1.000	1.000	EPN1_HUMAN Epsin-1 OS=Homo sapiens OX=9606 GN=EPN1 PE=1 SV=2
4	B2MVI1	3.63e-173	506	638	0.575	0.519	B2MVI1_LAMFL Epsin 1 (Fragment) OS=Lampetra fluviatilis OX=7748 PE=2 SV=1
5	Q8CHU3	3.09e-152	451	595	0.516	0.499	EPN2_MOUSE Epsin-2 OS=Mus musculus OX=10090 GN=Epn2 PE=1 SV=1
6	Q9Z1Z3	1.26e-141	424	583	0.514	0.508	EPN2_RAT Epsin-2 OS=Rattus norvegicus OX=10116 GN=Epn2 PE=1 SV=1
7	Q9H201	4.30e-139	419	632	0.484	0.441	EPN3_HUMAN Epsin-3 OS=Homo sapiens OX=9606 GN=EPN3 PE=2 SV=1
8	O95208	1.43e-133	405	641	0.502	0.451	EPN2_HUMAN Epsin-2 OS=Homo sapiens OX=9606 GN=EPN2 PE=1 SV=3
9	Q91W69	1.55e-131	400	636	0.491	0.445	EPN3_MOUSE Epsin-3 OS=Mus musculus OX=10090 GN=Epn3 PE=1 SV=1
10	I6L9I8	9.84e-115	345	318	0.292	0.528	I6L9I8_HUMAN EPN3 protein OS=Homo sapiens OX=9606 GN=EPN3 PE=1 SV=1
11	E9PBC1	3.38e-110	340	484	0.372	0.442	E9PBC1_HUMAN Epsin 2 OS=Homo sapiens OX=9606 GN=EPN2 PE=1 SV=1
12	M9PBU6	6.62e-106	333	637	0.411	0.372	M9PBU6_DROME Liquid facets, isoform I OS=Drosophila melanogaster OX=7227 GN=lqf PE=1 SV=1
13	M9PEM7	7.41e-106	333	630	0.411	0.376	M9PEM7_DROME Liquid facets, isoform G OS=Drosophila melanogaster OX=7227 GN=lqf PE=1 SV=1
14	A8JNM3	9.26e-106	333	640	0.434	0.391	A8JNM3_DROME Liquid facets, isoform F OS=Drosophila melanogaster OX=7227 GN=lqf PE=1 SV=1
15	Q7KU93	1.01e-104	335	784	0.411	0.302	Q7KU93_DROME Liquid facets, isoform C OS=Drosophila melanogaster OX=7227 GN=lqf PE=1 SV=1
16	M9PEF2	1.37e-104	334	791	0.411	0.300	M9PEF2_DROME Liquid facets, isoform J OS=Drosophila melanogaster OX=7227 GN=lqf PE=1 SV=1
17	Q9U741	1.79e-104	334	784	0.410	0.301	Q9U741_DROME Liquid facets OS=Drosophila melanogaster OX=7227 GN=lqf PE=2 SV=1
18	Q9VS85	5.89e-104	334	831	0.411	0.285	Q9VS85_DROME FI19443p1 OS=Drosophila melanogaster OX=7227 GN=lqf PE=1 SV=3
19	Q7KU90	5.92e-104	333	824	0.411	0.288	Q7KU90_DROME Liquid facets, isoform B OS=Drosophila melanogaster OX=7227 GN=lqf PE=1 SV=1
20	Q9BI71	1.22e-98	309	469	0.349	0.429	Q9BI71_CAEEL ENTH domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=epn-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07651 ANTH	0.071	23.7	ANTH domain
2	PF01417 ENTH	4.7e-48	173.8	ENTH domain
3	PF02809 UIM	0.54	21.3	Ubiquitin interaction motif
4	PF00790 VHS	12	17.2	VHS domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000011688

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000001582	0.996	Epidermal growth factor receptor pathway substrate 15
2	9601.ENSPPYP00000024307	0.984	Epidermal growth factor receptor pathway substrate 15-like 1
3	9601.ENSPPYP00000003365	0.961	Adaptor-related protein complex 2, alpha 2 subunit
4	9601.ENSPPYP00000024595	0.960	Kinase insert domain receptor (a type III receptor tyrosine kinase)
5	9601.ENSPPYP00000022550	0.957	RALBP1 associated Eps domain containing 2
6	9601.ENSPPYP00000011487	0.937	Adaptor-related protein complex 2, alpha 1 subunit
7	9601.ENSPPYP00000019671	0.927	Receptor protein-tyrosine kinase
8	9601.ENSPPYP00000012913	0.920	Clathrin heavy chain
9	9601.ENSPPYP00000016219	0.915	Cyclin G associated kinase
10	9601.ENSPPYP00000016043	0.882	Component of the adaptor protein complex 2 (AP-2). Adaptor protein complexes function in protein transport via transport vesicles in different membrane traffic pathways. Adaptor protein complexes are vesicle coat components and appear to be involved in cargo selection and vesicle formation. AP-2 is involved in clathrin-dependent endocytosis in which cargo proteins are incorporated into vesicles surrounded by clathrin (clathrin-coated vesicles, CCVs) which are destined for fusion with the early endosome. The clathrin lattice serves as a mechanical scaffold but is itself unable to bind d [...]
11	9601.ENSPPYP00000009891	0.879	Clathrin heavy chain
12	9601.ENSPPYP00000018816	0.862	Pongo abelii DKFZP459B053 protein (DKFZP459B053), mRNA
13	9601.ENSPPYP00000009302	0.854	Epsin 3
14	9601.ENSPPYP00000009206	0.842	Pongo abelii adaptor-related protein complex 2, beta 1 subunit (AP2B1), mRNA
15	9601.ENSPPYP00000012707	0.833	Intersectin 1 (SH3 domain protein)
16	9601.ENSPPYP00000019752	0.832	Amphiphysin
17	9601.ENSPPYP00000021369	0.826	Clathrin light chain
18	9601.ENSPPYP00000017987	0.822	Clathrin light chain
19	9601.ENSPPYP00000014069	0.819	Intersectin 2
20	9601.ENSPPYP00000004281	0.815	Phosphatidylinositol binding clathrin assembly protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140313	1.000	molecular sequestering activity
GO:0005515	1.000	protein binding
GO:0030276	0.926	clathrin binding
GO:0019899	0.563	enzyme binding
GO:0019904	0.557	protein domain specific binding
GO:0008289	0.411	lipid binding
GO:0060090	0.381	molecular adaptor activity
GO:0043167	0.303	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0050794	0.991	regulation of cellular process
GO:0006810	0.988	transport
GO:0009987	0.986	cellular process
GO:0006897	0.980	endocytosis
GO:0032501	0.966	multicellular organismal process
GO:0048518	0.949	positive regulation of biological process
GO:0071840	0.915	cellular component organization or biogenesis
GO:0016043	0.899	cellular component organization
GO:0048519	0.878	negative regulation of biological process
GO:0032502	0.868	developmental process
GO:0050896	0.861	response to stimulus
GO:0051128	0.854	regulation of cellular component organization
GO:0048522	0.854	positive regulation of cellular process
GO:0051239	0.842	regulation of multicellular organismal process
GO:0022603	0.842	regulation of anatomical structure morphogenesis
GO:0061024	0.822	membrane organization
GO:0007275	0.811	multicellular organism development
GO:2000026	0.803	regulation of multicellular organismal development
GO:0007154	0.769	cell communication
GO:0051241	0.752	negative regulation of multicellular organismal process
GO:0023052	0.722	signaling
GO:0045765	0.715	regulation of angiogenesis
GO:0051716	0.694	cellular response to stimulus
GO:0051641	0.694	cellular localization
GO:0051093	0.671	negative regulation of developmental process
GO:0048523	0.605	negative regulation of cellular process
GO:0007165	0.571	signal transduction
GO:0051649	0.518	establishment of localization in cell
GO:0000003	0.517	reproduction
GO:0007166	0.508	cell surface receptor signaling pathway
GO:1901343	0.497	negative regulation of vasculature development
GO:0051130	0.488	positive regulation of cellular component organization
GO:0016525	0.466	negative regulation of angiogenesis
GO:1903670	0.462	regulation of sprouting angiogenesis
GO:0044087	0.460	regulation of cellular component biogenesis
GO:0044706	0.440	multi-multicellular organism process
GO:0048731	0.365	system development
GO:0071704	0.351	organic substance metabolic process
GO:0019222	0.304	regulation of metabolic process
GO:0048513	0.302	animal organ development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0005829	0.995	cytosol
GO:0005634	0.964	nucleus
GO:0045202	0.888	synapse
GO:0098590	0.852	plasma membrane region
GO:0012505	0.551	endomembrane system
GO:0019898	0.475	extrinsic component of membrane
GO:0019897	0.441	extrinsic component of plasma membrane
GO:0097060	0.427	synaptic membrane
GO:0042995	0.415	cell projection
GO:0098793	0.415	presynapse
GO:0120025	0.407	plasma membrane bounded cell projection
GO:0098794	0.381	postsynapse
GO:0032991	0.369	protein-containing complex
GO:0031982	0.356	vesicle
GO:0031410	0.334	cytoplasmic vesicle
GO:0042734	0.330	presynaptic membrane
GO:0045211	0.307	postsynaptic membrane
GO:0043005	0.301	neuron projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]