StarFunc result for job id Q9Y6I4

User Input

>input (520 residues)
MECPHLSSSVCIAPDSAKFPNGSPSSWCCSVCRSNKSPWVCLTCSSVHCGRYVNGHAKKH
YEDAQVPLTNHKKSEKQDKVQHTVCMDCSSYSTYCYRCDDFVVNDTKLGLVQKVREHLQN
LENSAFTADRHKKRKLLENSTLNSKLLKVNGSTTAICATGLRNLGNTCFMNAILQSLSNI
EQFCCYFKELPAVELRNGKTAGRRTYHTRSQGDNNVSLVEEFRKTLCALWQGSQTAFSPE
SLFYVVWKIMPNFRGYQQQDAHEFMRYLLDHLHLELQGGFNGVSRSAILQENSTLSASNK
CCINGASTVVTAIFGGILQNEVNCLICGTESRKFDPFLDLSLDIPSQFRSKRSKNQENGP
VCSLRDCLRSFTDLEELDETELYMCHKCKKKQKSTKKFWIQKLPKVLCLHLKRFHWTAYL
RNKVDTYVEFPLRGLDMKCYLLEPENSGPESCLYDLAAVVVHHGSGVGSGHYTAYATHEG
RWFHFNDSTVTLTDEETVVKAKAYILFYVEHQAKAGSDKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q4JL29	0.941	0.941	5.173E-95	520	0.954	0.954	Q4JL29.pdb.gz	Q4JL29_RAT Ubiquitin carboxyl-terminal hydrolase OS=Rattus norvegicus OX=10116 GN=Usp3 PE=2 SV=1
2	AFDB:Q8C2S0	0.598	0.450	7.147E-42	711	0.344	0.252	Q8C2S0.pdb.gz	UBP44_MOUSE Ubiquitin carboxyl-terminal hydrolase 44 OS=Mus musculus OX=10090 GN=Usp44 PE=1 SV=3
3	AFDB:Q9H0E7	0.594	0.445	2.781E-41	712	0.350	0.256	Q9H0E7.pdb.gz	UBP44_HUMAN Ubiquitin carboxyl-terminal hydrolase 44 OS=Homo sapiens OX=9606 GN=USP44 PE=1 SV=2
4	AFDB:Q5DU02	0.558	0.553	1.437E-40	525	0.285	0.282	Q5DU02.pdb.gz	UBP22_MOUSE Ubiquitin carboxyl-terminal hydrolase 22 OS=Mus musculus OX=10090 GN=Usp22 PE=2 SV=2
5	AFDB:Q70EK9	0.533	0.397	1.609E-40	711	0.279	0.204	Q70EK9.pdb.gz	UBP51_HUMAN Ubiquitin carboxyl-terminal hydrolase 51 OS=Homo sapiens OX=9606 GN=USP51 PE=1 SV=1
6	AFDB:Q7ZUM8	0.605	0.462	1.802E-40	695	0.348	0.260	Q7ZUM8.pdb.gz	UBP44_DANRE Ubiquitin carboxyl-terminal hydrolase 44 OS=Danio rerio OX=7955 GN=usp44 PE=2 SV=1
7	AFDB:Q70CQ1	0.599	0.471	2.392E-40	688	0.348	0.263	Q70CQ1.pdb.gz	UBP49_HUMAN Ubiquitin carboxyl-terminal hydrolase 49 OS=Homo sapiens OX=9606 GN=USP49 PE=1 SV=1
8	AFDB:Q9LEW0	0.555	0.521	1.464E-39	557	0.262	0.244	Q9LEW0.pdb.gz	UBP22_ARATH Ubiquitin C-terminal hydrolase 22 OS=Arabidopsis thaliana OX=3702 GN=UBP22 PE=1 SV=1
9	AFDB:Q9VVR1	0.542	0.567	2.579E-39	496	0.256	0.268	Q9VVR1.pdb.gz	NOT_DROME Ubiquitin carboxyl-terminal hydrolase nonstop OS=Drosophila melanogaster OX=7227 GN=not PE=1 SV=4
10	AFDB:A5PN09	0.541	0.311	3.763E-37	911	0.304	0.173	A5PN09.pdb.gz	UBP20_DANRE Ubiquitin carboxyl-terminal hydrolase 20 OS=Danio rerio OX=7955 GN=usp20 PE=3 SV=1
11	PDB:3mhsA	0.506	0.575	1.276E-32	455	0.250	0.286	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
12	PDB:4fjcE	0.462	0.546	6.593E-29	434	0.246	0.295	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
13	PDB:5cvnB	0.509	0.804	9.260E-29	321	0.204	0.330	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
14	PDB:5k16B	0.511	0.784	2.820E-26	328	0.204	0.323	5k16B.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
15	PDB:4wa6D	0.455	0.566	3.342E-26	415	0.235	0.294	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
16	PDB:3ihpB	0.531	0.414	1.184E-24	681	0.213	0.163	3ihpB.pdb.gz	Covalent Ubiquitin-Usp5 Complex
17	PDB:7yxxA	0.491	0.154	9.262E-23	1754	0.187	0.055	7yxxA.pdb.gz
18	PDB:8a9kD	0.460	0.812	2.046E-22	285	0.165	0.302	8a9kD.pdb.gz	Cryo-EM reveals a mechanism of USP1 inhibition through a cryptic binding site.
19	PDB:7ay1D	0.520	0.774	3.815E-22	341	0.171	0.261	7ay1D.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
20	PDB:5k1bA	0.456	0.866	3.280E-21	264	0.202	0.398	5k1bA.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A0C2	0.0	958	482	0.888	0.959	A0A8I6A0C2_RAT Ubiquitin carboxyl-terminal hydrolase OS=Rattus norvegicus OX=10116 GN=Usp3 PE=1 SV=1
2	A0A8I6A351	0.0	971	506	0.904	0.929	A0A8I6A351_RAT Ubiquitin carboxyl-terminal hydrolase OS=Rattus norvegicus OX=10116 GN=Usp3 PE=1 SV=1
3	A1L1I5	0.0	833	423	0.765	0.941	A1L1I5_RAT ubiquitinyl hydrolase 1 OS=Rattus norvegicus OX=10116 GN=Usp3 PE=1 SV=1
4	D4A4F6	0.0	907	476	0.873	0.954	D4A4F6_RAT Ubiquitin carboxyl-terminal hydrolase OS=Rattus norvegicus OX=10116 GN=Usp3 PE=1 SV=4
5	H0YLB7	0.0	888	431	0.819	0.988	H0YLB7_HUMAN Ubiquitin carboxyl-terminal hydrolase OS=Homo sapiens OX=9606 GN=USP3 PE=1 SV=1
6	H0YMI4	0.0	1024	503	0.942	0.974	H0YMI4_HUMAN Ubiquitin carboxyl-terminal hydrolase OS=Homo sapiens OX=9606 GN=USP3 PE=1 SV=1
7	Q4JL29	0.0	1024	520	0.954	0.954	Q4JL29_RAT Ubiquitin carboxyl-terminal hydrolase OS=Rattus norvegicus OX=10116 GN=Usp3 PE=2 SV=1
8	Q6JHV3	0.0	1024	498	0.942	0.984	Q6JHV3_HUMAN Ubiquitin carboxyl-terminal hydrolase OS=Homo sapiens OX=9606 GN=USP3 PE=1 SV=1
9	Q9Y6I4	0.0	1087	520	1.000	1.000	UBP3_HUMAN Ubiquitin carboxyl-terminal hydrolase 3 OS=Homo sapiens OX=9606 GN=USP3 PE=1 SV=2
10	Q7ZUM8	9.50e-62	216	695	0.290	0.217	UBP44_DANRE Ubiquitin carboxyl-terminal hydrolase 44 OS=Danio rerio OX=7955 GN=usp44 PE=2 SV=1
11	E9QFQ5	4.31e-58	200	404	0.240	0.309	E9QFQ5_DANRE Ubiquitin carboxyl-terminal hydrolase OS=Danio rerio OX=7955 GN=usp21 PE=3 SV=2
12	O57429	3.39e-56	193	357	0.258	0.375	UBP2_CHICK Ubiquitin carboxyl-terminal hydrolase 2 OS=Gallus gallus OX=9031 GN=USP2 PE=2 SV=1
13	Q8C2S0	4.30e-55	199	711	0.273	0.200	UBP44_MOUSE Ubiquitin carboxyl-terminal hydrolase 44 OS=Mus musculus OX=10090 GN=Usp44 PE=1 SV=3
14	O75604	5.07e-54	194	605	0.267	0.230	UBP2_HUMAN Ubiquitin carboxyl-terminal hydrolase 2 OS=Homo sapiens OX=9606 GN=USP2 PE=1 SV=2
15	Q70CQ1	5.17e-54	195	688	0.267	0.202	UBP49_HUMAN Ubiquitin carboxyl-terminal hydrolase 49 OS=Homo sapiens OX=9606 GN=USP49 PE=1 SV=1
16	H1UUC2	2.35e-53	186	367	0.237	0.335	H1UUC2_DROME FI18309p1 OS=Drosophila melanogaster OX=7227 GN=Usp8 PE=2 SV=1
17	Q70EK9	2.94e-53	193	711	0.296	0.217	UBP51_HUMAN Ubiquitin carboxyl-terminal hydrolase 51 OS=Homo sapiens OX=9606 GN=USP51 PE=1 SV=1
18	Q5U349	3.79e-53	192	618	0.265	0.223	UBP2_RAT Ubiquitin carboxyl-terminal hydrolase 2 OS=Rattus norvegicus OX=10116 GN=Usp2 PE=1 SV=1
19	Q9UPT9	6.33e-53	189	525	0.279	0.276	UBP22_HUMAN Ubiquitin carboxyl-terminal hydrolase 22 OS=Homo sapiens OX=9606 GN=USP22 PE=1 SV=2
20	O88623	1.05e-52	191	619	0.263	0.221	UBP2_MOUSE Ubiquitin carboxyl-terminal hydrolase 2 OS=Mus musculus OX=10090 GN=Usp2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00443 UCH	3.9e-63	225.2	Ubiquitin carboxyl-terminal hydrolase
2	PF13423 UCH_1	5.2e-14	64.2	Ubiquitin carboxyl-terminal hydrolase
3	PF02148 zf-UBP	1.9e-16	71.5	Zn-finger in ubiquitin-hydrolases and other protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000369681

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000441543	0.977	Polyubiquitin-C
2	9606.ENSP00000272317	0.959	Ubiquitin-40S ribosomal protein S27a
3	9606.ENSP00000388107	0.958	Ubiquitin-60S ribosomal protein L40
4	9606.ENSP00000304697	0.931	Polyubiquitin-B
5	9606.ENSP00000307684	0.827	Transcriptional adapter 3
6	9606.ENSP00000352925	0.820	Transformation/transcription domain-associated protein
7	9606.ENSP00000444357	0.812	Ubiquitin thioesterase OTUB1
8	9606.ENSP00000332194	0.798	Histone H2A type 2-C
9	9606.ENSP00000358151	0.796	Histone H2B type 2-E
10	9606.ENSP00000335605	0.760	CKLF like MARVEL transmembrane domain containing 7
11	9606.ENSP00000482674	0.749	Histone H2B type 1-B
12	9606.ENSP00000316176	0.737	Ubiquitin-conjugating enzyme E2 N
13	9606.ENSP00000439585	0.735	Ataxin-7
14	9606.ENSP00000308022	0.727	Transcriptional adapter 2-beta
15	9606.ENSP00000326759	0.724	Leucine-rich repeats and immunoglobulin-like domains protein 3
16	9606.ENSP00000225916	0.712	Histone acetyltransferase KAT2A
17	9606.ENSP00000299424	0.712	Transcription initiation factor TFIID subunit 10
18	9606.ENSP00000203664	0.705	Ubiquitin thioesterase OTUB2
19	9606.ENSP00000358474	0.698	Lys-63-specific deubiquitinase BRCC36
20	9606.ENSP00000339917	0.697	Transcription initiation factor TFIID subunit 9B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990841	1.000	promoter-specific chromatin binding
GO:0000978	1.000	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0101005	0.996	deubiquitinase activity
GO:0005515	0.994	protein binding
GO:0004843	0.988	cysteine-type deubiquitinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006355	0.997	regulation of DNA-templated transcription
GO:0010558	0.995	negative regulation of macromolecule biosynthetic process
GO:0051253	0.995	negative regulation of RNA metabolic process
GO:0006357	0.986	regulation of transcription by RNA polymerase II
GO:0045892	0.965	negative regulation of DNA-templated transcription
GO:0000122	0.955	negative regulation of transcription by RNA polymerase II
GO:0071704	0.806	organic substance metabolic process
GO:0044238	0.791	primary metabolic process
GO:0009987	0.790	cellular process
GO:0006807	0.785	nitrogen compound metabolic process
GO:0043170	0.770	macromolecule metabolic process
GO:0019538	0.670	protein metabolic process
GO:0036211	0.574	protein modification process
GO:0070647	0.539	protein modification by small protein conjugation or removal
GO:0016579	0.511	protein deubiquitination
GO:0044237	0.378	cellular metabolic process
GO:0050896	0.346	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.996	nucleoplasm
GO:0043232	0.994	intracellular non-membrane-bounded organelle
GO:0005737	0.993	cytoplasm
GO:0032991	0.841	protein-containing complex
GO:0005694	0.602	chromosome
GO:0000785	0.442	chromatin
GO:0099080	0.410	supramolecular complex
GO:0035770	0.349	ribonucleoprotein granule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	1.000	Acting on peptide bonds (peptidases).
EC:3.4.19.12	0.988	ubiquitinyl hydrolase 1.

[back to server]