StarFunc result for job id Q9Y6I7

User Input

>input (421 residues)
MASFPPRVNEKEIVRLRTIGELLAPAAPFDKKCGRENWTVAFAPDGSYFAWSQGHRTVKL
VPWSQCLQNFLLHGTKNVTNSSSLRLPRQNSDGGQKNKPREHIIDCGDIVWSLAFGSSVP
EKQSRCVNIEWHRFRFGQDQLLLATGLNNGRIKIWDVYTGKLLLNLVDHTEVVRDLTFAP
DGSLILVSASRDKTLRVWDLKDDGNMMKVLRGHQNWVYSCAFSPDSSMLCSVGASKAVFL
WNMDKYTMIRKLEGHHHDVVACDFSPDGALLATASYDTRVYIWDPHNGDILMEFGHLFPP
PTPIFAGGANDRWVRSVSFSHDGLHVASLADDKMVRFWRIDEDYPVQVAPLSNGLCCAFS
TDGSVLAAGTHDGSVYFWATPRQVPSLQHLCRMSIRRVMPTQEVQELPIPSKLLEFLSYR
I

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O54927	0.966	0.966	9.585E-75	421	0.926	0.926	O54927.pdb.gz	WSB1_MOUSE WD repeat and SOCS box-containing protein 1 OS=Mus musculus OX=10090 GN=Wsb1 PE=1 SV=1
2	AFDB:Q9NYS7	0.817	0.850	1.899E-48	404	0.482	0.502	Q9NYS7.pdb.gz	WSB2_HUMAN WD repeat and SOCS box-containing protein 2 OS=Homo sapiens OX=9606 GN=WSB2 PE=2 SV=1
3	AFDB:Q9UUG8	0.611	0.439	7.514E-21	598	0.204	0.144	Q9UUG8.pdb.gz	TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tup12 PE=1 SV=2
4	AFDB:Q2TAY7	0.619	0.514	1.396E-20	513	0.162	0.133	Q2TAY7.pdb.gz	SMU1_HUMAN WD40 repeat-containing protein SMU1 OS=Homo sapiens OX=9606 GN=SMU1 PE=1 SV=2
5	AFDB:Q1LV15	0.584	0.591	1.548E-20	415	0.195	0.198	Q1LV15.pdb.gz	DAW1_DANRE Dynein assembly factor with WD repeat domains 1 OS=Danio rerio OX=7955 GN=daw1 PE=1 SV=2
6	AFDB:Q9VE18	0.608	0.507	2.004E-20	509	0.162	0.134	Q9VE18.pdb.gz	Q9VE18_DROME WD40 repeat-containing protein SMU1 OS=Drosophila melanogaster OX=7227 GN=Smu1 PE=1 SV=2
7	AFDB:Q9VU65	0.640	0.686	2.731E-20	391	0.166	0.179	Q9VU65.pdb.gz	POC1_DROME POC1 centriolar protein homolog OS=Drosophila melanogaster OX=7227 GN=Poc1 PE=2 SV=1
8	AFDB:Q8NBT0	0.630	0.651	2.876E-20	407	0.183	0.189	Q8NBT0.pdb.gz	POC1A_HUMAN POC1 centriolar protein homolog A OS=Homo sapiens OX=9606 GN=POC1A PE=1 SV=2
9	AFDB:Q8W117	0.609	0.505	4.819E-20	511	0.157	0.129	Q8W117.pdb.gz	SMU1_ARATH Suppressor of mec-8 and unc-52 protein homolog 1 OS=Arabidopsis thaliana OX=3702 GN=SMU1 PE=1 SV=1
10	AFDB:O14727	0.625	0.219	5.074E-20	1248	0.185	0.062	O14727.pdb.gz	APAF_HUMAN Apoptotic protease-activating factor 1 OS=Homo sapiens OX=9606 GN=APAF1 PE=1 SV=2
11	PDB:5mzhB	0.572	0.580	1.045E-19	415	0.178	0.181	5mzhB.pdb.gz
12	PDB:7bt6x	0.555	0.484	2.934E-19	488	0.200	0.172	7bt6x.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
13	PDB:5jcsq	0.558	0.487	3.153E-18	488	0.181	0.156	5jcsq.pdb.gz	Architecture of the Rix1-Rea1 checkpoint machinery during pre-60S-ribosome remodeling
14	PDB:2h9lA	0.626	0.809	4.765E-18	321	0.173	0.227	2h9lA.pdb.gz
15	PDB:3sfzA	0.639	0.244	8.853E-18	1133	0.185	0.069	3sfzA.pdb.gz	Crystal structure of full-length Apaf-1: how the death signal is relayed in the mitochondrial pathway of apoptosis.
16	PDB:1vyhC	0.559	0.748	1.271E-17	310	0.185	0.252	1vyhC.pdb.gz
17	PDB:3jcmB	0.587	0.576	1.271E-17	429	0.171	0.168	3jcmB.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
18	PDB:5nnzA	0.529	0.651	1.824E-17	335	0.195	0.245	5nnzA.pdb.gz
19	PDB:3fm0A	0.609	0.771	2.361E-17	328	0.197	0.253	3fm0A.pdb.gz
20	PDB:7pzyh	0.607	0.811	2.486E-17	311	0.195	0.264	7pzyh.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O54927	0.0	821	421	0.926	0.926	WSB1_MOUSE WD repeat and SOCS box-containing protein 1 OS=Mus musculus OX=10090 GN=Wsb1 PE=1 SV=1
2	Q9Y6I7	0.0	875	421	1.000	1.000	WSB1_HUMAN WD repeat and SOCS box-containing protein 1 OS=Homo sapiens OX=9606 GN=WSB1 PE=1 SV=1
3	Q9NYS7	1.33e-133	391	404	0.487	0.507	WSB2_HUMAN WD repeat and SOCS box-containing protein 2 OS=Homo sapiens OX=9606 GN=WSB2 PE=2 SV=1
4	P61964	1.32e-28	116	334	0.202	0.254	WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens OX=9606 GN=WDR5 PE=1 SV=1
5	P61965	1.32e-28	116	334	0.202	0.254	WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus OX=10090 GN=Wdr5 PE=1 SV=1
6	Q498M4	1.32e-28	116	334	0.202	0.254	WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus OX=10116 GN=Wdr5 PE=1 SV=1
7	Q7ZTX2	1.83e-28	116	334	0.202	0.254	Q7ZTX2_DANRE WD repeat domain 5 OS=Danio rerio OX=7955 GN=wu:fk47f04 PE=1 SV=1
8	Q9V3J8	3.09e-27	113	361	0.176	0.205	WDS_DROME Protein will die slowly OS=Drosophila melanogaster OX=7227 GN=wds PE=1 SV=1
9	Q9D994	4.43e-27	112	303	0.190	0.264	WDR38_MOUSE WD repeat-containing protein 38 OS=Mus musculus OX=10090 GN=Wdr38 PE=2 SV=1
10	Q54KL5	1.50e-26	111	335	0.171	0.215	WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum OX=44689 GN=wdr5 PE=3 SV=1
11	Q4V8C4	4.09e-25	107	328	0.166	0.213	WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus OX=10116 GN=Wdr5b PE=2 SV=1
12	P0CY34	4.63e-25	109	512	0.185	0.152	TUP1_CANAL Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TUP1 PE=2 SV=1
13	Q17963	1.08e-24	106	376	0.173	0.194	WDR51_CAEEL WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans OX=6239 GN=wdr-5.1 PE=1 SV=1
14	Q9M2Z2	2.25e-23	102	317	0.173	0.230	WDR5A_ARATH COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana OX=3702 GN=WDR5A PE=1 SV=1
15	Q8IBA0	4.00e-23	101	323	0.169	0.220	Q8IBA0_PLAF7 Receptor for activated c kinase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0826700 PE=3 SV=1
16	O22212	6.79e-22	100	554	0.169	0.128	PRP4L_ARATH U4/U6 small nuclear ribonucleoprotein PRP4-like protein OS=Arabidopsis thaliana OX=3702 GN=LIS PE=2 SV=1
17	O43017	7.53e-22	98.6	380	0.143	0.158	SWD3_SCHPO Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=swd3 PE=1 SV=1
18	Q4VFZ4	1.18e-21	99.8	655	0.171	0.110	Q4VFZ4_RAT Katanin p80 WD40 repeat-containing subunit B1 OS=Rattus norvegicus OX=10116 GN=Katnb1 PE=2 SV=1
19	B1WBN6	1.21e-21	99.8	640	0.171	0.113	B1WBN6_RAT Katnb1 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Katnb1 PE=2 SV=1
20	Q23256	1.25e-21	99.0	501	0.150	0.126	WDR53_CAEEL WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans OX=6239 GN=wdr-5.3 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	5.6e-11	53.9	Anaphase-promoting complex subunit 4 WD40 domain
2	PF08662 eIF2A	0.039	25.4	Eukaryotic translation initiation factor eIF2A
3	PF16529 Ge1_WD40	1.1e-07	42.9	WD40 region of Ge1, enhancer of mRNA-decapping protein
4	PF07569 Hira	2.8e+02	12.5	TUP1-like enhancer of split
5	PF15492 Nbas_N	0.99	20.3	Neuroblastoma-amplified sequence, N terminal
6	PF20426 NBCH_WD40	1.6e-13	61.8	Neurobeachin beta propeller domain
7	PF11715 Nup160	12	16.1	Nucleoporin Nup120/160
8	PF07676 PD40	1.9e+02	13.4	WD40-like Beta Propeller Repeat
9	PF13570 PQQ_3	39	16.2	PQQ-like domain
10	PF07525 SOCS_box	2.3e-07	42.4	SOCS box
11	PF00400 WD40	2.7e-32	121.5	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262394

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376808	0.950	Cullin-5
2	9606.ENSP00000262306	0.895	Elongin-B
3	9606.ENSP00000450980	0.860	Responsible for the deiodination of T4 (3,5,3',5'- tetraiodothyronine)
4	9606.ENSP00000478121	0.810	Elongin-C
5	9606.ENSP00000313811	0.801	Ubiquitin carboxyl-terminal hydrolase 20
6	9606.ENSP00000385571	0.767	Homeodomain-interacting protein kinase 2
7	9606.ENSP00000264010	0.731	Transcriptional repressor CTCF
8	9606.ENSP00000250495	0.700	NEDD8
9	9606.ENSP00000359829	0.685	Ubiquitin carboxyl-terminal hydrolase 33
10	9606.ENSP00000349156	0.677	E3 ubiquitin-protein ligase SIAH1
11	9606.ENSP00000391826	0.659	Insulin-like growth factor II
12	9606.ENSP00000296490	0.637	WD repeat-containing protein 82
13	9606.ENSP00000351015	0.614	Neurofibromin
14	9606.ENSP00000419475	0.607	COMM domain-containing protein 2
15	9606.ENSP00000263401	0.600	COMM domain-containing protein 9
16	9606.ENSP00000267935	0.600	COMM domain-containing protein 4
17	9606.ENSP00000274458	0.600	COMM domain-containing protein 10
18	9606.ENSP00000278980	0.600	COMM domain-containing protein 7
19	9606.ENSP00000308236	0.600	COMM domain-containing protein 1
20	9606.ENSP00000348054	0.600	COMM domain containing 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0140096	0.946	catalytic activity, acting on a protein
GO:0019787	0.814	ubiquitin-like protein transferase activity
GO:0004842	0.627	ubiquitin-protein transferase activity
GO:1901363	0.518	heterocyclic compound binding
GO:0097159	0.517	organic cyclic compound binding
GO:0061659	0.509	ubiquitin-like protein ligase activity
GO:0061630	0.495	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0043170	0.991	macromolecule metabolic process
GO:0044238	0.990	primary metabolic process
GO:0009987	0.989	cellular process
GO:0006807	0.985	nitrogen compound metabolic process
GO:1901564	0.962	organonitrogen compound metabolic process
GO:0019538	0.947	protein metabolic process
GO:0016567	0.889	protein ubiquitination
GO:0065007	0.853	biological regulation
GO:0050789	0.838	regulation of biological process
GO:0071840	0.835	cellular component organization or biogenesis
GO:0000209	0.828	protein polyubiquitination
GO:0050794	0.751	regulation of cellular process
GO:0044237	0.544	cellular metabolic process
GO:0019222	0.446	regulation of metabolic process
GO:0016043	0.435	cellular component organization
GO:0044085	0.415	cellular component biogenesis
GO:0060255	0.415	regulation of macromolecule metabolic process
GO:0080090	0.364	regulation of primary metabolic process
GO:0051171	0.364	regulation of nitrogen compound metabolic process
GO:0010468	0.352	regulation of gene expression
GO:0048518	0.339	positive regulation of biological process
GO:0031323	0.317	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.992	cytosol
GO:0043226	0.435	organelle
GO:0043229	0.416	intracellular organelle
GO:0043227	0.408	membrane-bounded organelle
GO:0043231	0.378	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.814	Transferases.

[back to server]