StarFunc result for job id Q9Y6J0

User Input

>input (2220 residues)
MIRIAALNASSTIEDDHEGSFKSHKTQTKEAQEAEAFALYHKALDLQKHDRFEESAKAYH
ELLEASLLREAVSSGDEKEGLKHPGLILKYSTYKNLAQLAAQREDLETAMEFYLEAVMLD
STDVNLWYKIGHVALRLIRIPLARHAFEEGLRCNPDHWPCLDNLITVLYTLSDYTTCLYF
ICKALEKDCRYSKGLVLKEKIFEEQPCLRKDSLRMFLKCDMSIHDVSVSAAETQAIVDEA
LGLRKKRQALIVREKEPDLKLVQPIPFFTWKCLGESLLAMYNHLTTCEPPRPSLGKRIDL
SDYQDPSQPLESSMVVTPVNVIQPSTVSTNPAVAVAEPVVSYTSVATTSFPLHSPGLLET
GAPVGDISGGDKSKKGVKRKKISEESGETAKRRSARVRNTKCKKEEKVDFQELLMKFLPS
RLRKLDPEEEDDSFNNYEVQSEAKLESFPSIGPQRLSFDSATFMESEKQDVHEFLLENLT
NGGILELMMRYLKAMGHKFLVRWPPGLAEVVLSVYHSWRRHSTSLPNPLLRDCSNKHIKD
MMLMSLSCMELQLDQWLLTKGRSSAVSPRNCPAGMVNGRFGPDFPGTHCLGDLLQLSFAS
SQRDLFEDGWLEFVVRVYWLKARFLALQGDMEQALENYDICTEMLQSSTAIQVEAGAERR
DIVIRLPNLHNDSVVSLEEIDKNLKSLERCQSLEEIQRLYEAGDYKAVVHLLRPTLCTSG
FDRAKHLEFMTSIPERPAQLLLLQDSLLRLKDYRQCFECSDVALNEAVQQMVNSGEAAAK
EEWVATVTQLLMGIEQALSADSSGSILKVSSSTTGLVRLTNNLIQVIDCSMAVQEEAKEP
HVSSVLPWIILHRIIWQEEDTFHSLCHQQQLQNPAEEGMSETPMLPSSLMLLNTAHEYLG
RRSWCCNSDGALLRFYVRVLQKELAASTSEDTHPYKEELETALEQCFYCLYSFPSKKSKA
RYLEEHSAQQVDLIWEDALFMFEYFKPKTLPEFDSYKTSTVSADLANLLKRIATIVPRTE
RPALSLDKVSAYIEGTSTEVPCLPEGADPSPPVVNELYYLLADYHFKNKEQSKAIKFYMH
DICICPNRFDSWAGMALARASRIQDKLNSNELKSDGPIWKHATPVLNCFRRALEIDSSNL
SLWIEYGTMSYALHSFASRQLKQWRGELPPELVQQMEGRRDSMLETAKHCFTSAARCEGD
GDEEEWLIHYMLGKVAEKQQQPPTVYLLHYRQAGHYLHEEAARYPKKIHYHNPPELAMEA
LEVYFRLHASILKLLGKPDSGVGAEVLVNFMKEAAEGPFARGEEKNTPKASEKEKACLVD
EDSHSSAGTLPGPGASLPSSSGPGLTSPPYTATPIDHDYVKCKKPHQQATPDDRSQDSTA
VALSDSSSTQDFFNEPTSLLEGSRKSYTEKRLPILSSQAGATGKDLQGATEERGKNEESL
ESTEGFRAAEQGVQKPAAETPASACIPGKPSASTPTLWDGKKRGDLPGEPVAFPQGLPAG
AEEQRQFLTEQCIASFRLCLSRFPQHYKSLYRLAFLYTYSKTHRNLQWARDVLLGSSIPW
QQLQHMPAQGLFCERNKTNFFNGIWRIPVDEIDRPGSFAWHMNRSIVLLLKVLAQLRDHS
TLLKVSSMLQRTPDQGKKYLRDADRQVLAQRAFILTVKVLEDTLSELAEGSERPGPKVCG
LPGARMTTDVSHKASPEDGQEGLPQPKKPPLADGSGPGPEPGGKVGLLNHRPVAMDAGDS
ADQSGERKDKESPRAGPTEPMDTSEATVCHSDLERTPPLLPGRPARDRGPESRPTELSLE
ELSISARQQPTPLTPAQPAPAPAPATTTGTRAGGHPEEPLSRLSRKRKLLEDTESGKTLL
LDAYRVWQQGQKGVAYDLGRVERIMSETYMLIKQVDEEAALEQAVKFCQVHLGAAAQRQA
SGDTPTTPKHPKDSRENFFPVTVVPTAPDPVPADSVQRPSDAHTKPRPALAAATTIITCP
PSASASTLDQSKDPGPPRPHRPEATPSMASLGPEGEELARVAEGTSFPPQEPRHSPQVKM
APTSSPAEPHCWPAEAALGTGAEPTCSQEGKLRPEPRRDGEAQEAASETQPLSSPPTAAS
SKAPSSGSAQPPEGHPGKPEPSRAKSRPLPNMPKLVIPSAATKFPPEITVTPPTPTLLSP
KGSISEETKQKLKSAILSAQSAANVRKESLCQPALEVLETSSQESSLESETDEDDDYMDI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G3X8Q1	0.804	0.816	0.000	2187	0.886	0.900	G3X8Q1.pdb.gz	G3X8Q1_MOUSE Calcineurin binding protein 1 OS=Mus musculus OX=10090 GN=Cabin1 PE=1 SV=1
2	AFDB:Q9Y6J0	1.000	1.000	0.000	2220	1.000	1.000	Q9Y6J0.pdb.gz	CABIN_HUMAN Calcineurin-binding protein cabin-1 OS=Homo sapiens OX=9606 GN=CABIN1 PE=1 SV=1
3	AFDB:Q96AY4	0.086	0.081	1.471E-14	2481	0.141	0.126	Q96AY4.pdb.gz	TTC28_HUMAN Tetratricopeptide repeat protein 28 OS=Homo sapiens OX=9606 GN=TTC28 PE=1 SV=4
4	PDB:4bujB	0.078	0.103	6.225E-8	1367	0.075	0.122	4bujB.pdb.gz
5	AFDB:Q9VW47	0.099	0.091	6.888E-8	2531	0.114	0.100	Q9VW47.pdb.gz	MED12_DROME Mediator of RNA polymerase II transcription subunit 12 OS=Drosophila melanogaster OX=7227 GN=kto PE=1 SV=2
6	AFDB:P29539	0.098	0.107	8.578E-8	1916	0.100	0.116	P29539.pdb.gz	RIF1_YEAST Telomere length regulator protein RIF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RIF1 PE=1 SV=3
7	AFDB:F4IAT2	0.061	0.067	1.719E-7	1823	0.114	0.139	F4IAT2.pdb.gz	THOC2_ARATH THO complex subunit 2 OS=Arabidopsis thaliana OX=3702 GN=THO2 PE=1 SV=1
8	AFDB:Q5UIP0	0.113	0.107	3.842E-7	2472	0.097	0.087	Q5UIP0.pdb.gz	RIF1_HUMAN Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2
9	AFDB:P49815	0.090	0.098	8.910E-7	1807	0.090	0.110	P49815.pdb.gz	TSC2_HUMAN Tuberin OS=Homo sapiens OX=9606 GN=TSC2 PE=1 SV=2
10	PDB:7qdrB	0.110	0.161	1.119E-6	1212	0.060	0.110	7qdrB.pdb.gz
11	PDB:6yj6A	0.077	0.170	2.325E-6	819	0.053	0.143	6yj6A.pdb.gz
12	PDB:7dkhI	0.079	0.158	2.792E-6	914	0.050	0.123	7dkhI.pdb.gz
13	AFDB:Q9H254	0.039	0.035	2.871E-6	2564	0.118	0.102	Q9H254.pdb.gz	SPTN4_HUMAN Spectrin beta chain, non-erythrocytic 4 OS=Homo sapiens OX=9606 GN=SPTBN4 PE=1 SV=2
14	AFDB:Q61037	0.092	0.101	3.709E-6	1814	0.089	0.109	Q61037.pdb.gz	TSC2_MOUSE Tuberin OS=Mus musculus OX=10090 GN=Tsc2 PE=1 SV=1
15	PDB:6tedQ	0.089	0.142	5.400E-5	890	0.056	0.140	6tedQ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
16	PDB:7sqcR1	0.088	0.092	9.010E-5	2080	0.064	0.068	7sqcR1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
17	PDB:8a3tH	0.075	0.233	2.014E-4	505	0.037	0.162	8a3tH.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
18	PDB:7qe7J	0.073	0.270	2.699E-4	510	0.030	0.131	7qe7J.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
19	PDB:8a3tD	0.077	0.230	3.012E-4	560	0.039	0.154	8a3tD.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
20	PDB:5dseA	0.071	0.183	3.486E-4	537	0.034	0.140	5dseA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WWW8	0.0	4455	2170	0.977	1.000	A0A087WWW8_HUMAN Calcineurin binding protein 1 OS=Homo sapiens OX=9606 GN=CABIN1 PE=1 SV=1
2	A0A1W2P8C4	0.0	890	473	0.191	0.894	A0A1W2P8C4_MOUSE Calcineurin binding protein 1 (Fragment) OS=Mus musculus OX=10090 GN=Cabin1 PE=1 SV=1
3	B5MEB3	0.0	991	590	0.254	0.954	B5MEB3_HUMAN Calcineurin binding protein 1 OS=Homo sapiens OX=9606 GN=CABIN1 PE=1 SV=1
4	B9EKC5	0.0	3883	2187	0.883	0.897	B9EKC5_MOUSE Calcineurin binding protein 1 OS=Mus musculus OX=10090 GN=Cabin1 PE=2 SV=1
5	G3X8Q1	0.0	3888	2187	0.884	0.898	G3X8Q1_MOUSE Calcineurin binding protein 1 OS=Mus musculus OX=10090 GN=Cabin1 PE=1 SV=1
6	O88480	0.0	3878	2182	0.880	0.895	CABIN_RAT Calcineurin-binding protein cabin-1 OS=Rattus norvegicus OX=10116 GN=Cabin1 PE=1 SV=1
7	Q3TDW4	0.0	852	606	0.218	0.797	Q3TDW4_MOUSE Calcineurin-binding protein cabin-1 MEF2-binding domain-containing protein OS=Mus musculus OX=10090 GN=Cabin1 PE=2 SV=1
8	Q3TGB0	0.0	744	402	0.170	0.940	Q3TGB0_MOUSE Uncharacterized protein (Fragment) OS=Mus musculus OX=10090 GN=Cabin1 PE=2 SV=1
9	Q6PFH4	0.0	1932	1036	0.432	0.925	Q6PFH4_MOUSE Cabin1 protein OS=Mus musculus OX=10090 GN=Cabin1 PE=2 SV=1
10	Q8CGG3	0.0	739	409	0.169	0.919	Q8CGG3_MOUSE Similar to cain (Fragment) OS=Mus musculus OX=10090 GN=Cabin1 PE=2 SV=1
11	Q9Y6J0	0.0	4580	2220	1.000	1.000	CABIN_HUMAN Calcineurin-binding protein cabin-1 OS=Homo sapiens OX=9606 GN=CABIN1 PE=1 SV=1
12	Q6PH97	3.98e-177	548	414	0.147	0.790	Q6PH97_MOUSE Cabin1 protein (Fragment) OS=Mus musculus OX=10090 GN=Cabin1 PE=2 SV=1
13	A0A1W2P819	6.53e-93	301	191	0.073	0.853	A0A1W2P819_MOUSE Calcineurin binding protein 1 (Fragment) OS=Mus musculus OX=10090 GN=Cabin1 PE=1 SV=1
14	Q80X22	5.74e-87	285	218	0.078	0.798	Q80X22_MOUSE Cabin1 protein (Fragment) OS=Mus musculus OX=10090 GN=Cabin1 PE=2 SV=1
15	Q3TC43	4.46e-63	212	107	0.046	0.953	Q3TC43_MOUSE Uncharacterized protein (Fragment) OS=Mus musculus OX=10090 GN=Cabin1 PE=2 SV=1
16	A0A1W2P6X4	3.25e-13	67.8	39	0.014	0.795	A0A1W2P6X4_MOUSE Calcineurin binding protein 1 (Fragment) OS=Mus musculus OX=10090 GN=Cabin1 PE=4 SV=1
17	A0A1W2P8A1	0.003	38.9	18	0.008	1.000	A0A1W2P8A1_MOUSE Calcineurin binding protein 1 (Fragment) OS=Mus musculus OX=10090 GN=Cabin1 PE=4 SV=1
18	Q8LGU6	0.005	44.7	744	0.011	0.032	CD27B_ARATH Cell division cycle protein 27 homolog B OS=Arabidopsis thaliana OX=3702 GN=CDC27B PE=1 SV=1
19	M9PC48	0.050	41.6	18095	0.019	0.002	M9PC48_DROME Dumpy, isoform Y OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
20	M9PCJ6	0.050	41.6	18641	0.019	0.002	M9PCJ6_DROME Dumpy, isoform S OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02259 FAT	24	15.6	FAT domain
2	PF09047 MEF2_binding	7.3e-20	81.8	MEF2 binding
3	PF20308 TPR-S	10	18.1	Tetratricopeptide Repeats-Sensor
4	PF00515 TPR_1	0.065	24.3	Tetratricopeptide repeat
5	PF13414 TPR_11	0.049	24.6	TPR repeat
6	PF13428 TPR_14	75	15.5	Tetratricopeptide repeat
7	PF13432 TPR_16	6.1	18.8	Tetratricopeptide repeat
8	PF07719 TPR_2	7.7e-06	36.7	Tetratricopeptide repeat
9	PF13176 TPR_7	7.7e+02	11.6	Tetratricopeptide repeat
10	PF13181 TPR_8	0.026	25.7	Tetratricopeptide repeat
11	PF13371 TPR_9	6e+02	11.9	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000381364

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000379894	0.999	Ubinuclein-1
2	9606.ENSP00000229595	0.993	Histone chaperone ASF1A
3	9606.ENSP00000263208	0.990	Protein HIRA
4	9606.ENSP00000271555	0.990	Myocyte-specific enhancer factor 2D
5	9606.ENSP00000402154	0.986	Myocyte-specific enhancer factor 2B
6	9606.ENSP00000390762	0.984	Transcriptional activator which binds specifically to the MEF2 element, 5'-YTA[AT](4)TAR-3', found in numerous muscle-specific genes. Activates transcription via this element. May be involved in muscle-specific and/or growth factor-related transcription
7	9606.ENSP00000346389	0.969	Myocyte-specific enhancer factor 2A
8	9606.ENSP00000378323	0.964	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform
9	9606.ENSP00000340874	0.958	Myocyte-specific enhancer factor 2C
10	9606.ENSP00000269305	0.956	Cellular tumor antigen p53
11	9606.ENSP00000371267	0.952	14-3-3 protein theta
12	9606.ENSP00000378306	0.944	Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform
13	9606.ENSP00000263253	0.938	Histone acetyltransferase p300
14	9606.ENSP00000379330	0.936	Nuclear factor of activated T-cells, cytoplasmic 2
15	9606.ENSP00000282356	0.932	Calcium/calmodulin-dependent protein kinase type IV
16	9606.ENSP00000362649	0.929	Histone deacetylase 1
17	9606.ENSP00000430432	0.927	Histone deacetylase 2
18	9606.ENSP00000380878	0.925	Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform
19	9606.ENSP00000250003	0.913	Myoblast determination protein 1
20	9606.ENSP00000374213	0.913	E1A-binding protein p400

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.525	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0050794	0.997	regulation of cellular process
GO:0023052	0.994	signaling
GO:0007154	0.993	cell communication
GO:0051716	0.985	cellular response to stimulus
GO:0007165	0.977	signal transduction
GO:0048519	0.479	negative regulation of biological process
GO:0071840	0.398	cellular component organization or biogenesis
GO:0016043	0.373	cellular component organization
GO:0048523	0.362	negative regulation of cellular process
GO:0019222	0.344	regulation of metabolic process
GO:0048518	0.325	positive regulation of biological process
GO:0031323	0.325	regulation of cellular metabolic process
GO:0080090	0.324	regulation of primary metabolic process
GO:0060255	0.324	regulation of macromolecule metabolic process
GO:0006325	0.323	chromatin organization
GO:0048522	0.322	positive regulation of cellular process
GO:0051171	0.321	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016235	1.000	aggresome
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0032991	0.620	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]