StarFunc result for job id Q9Y6J6

User Input

>input (123 residues)
MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAENFYYVILYLMVMIGMF
SFIIVAILVSTVKSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFK
MSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Click to view	Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
	1	AFDB:Q9Y6J6	1.000	1.000	1.188E-17	123	1.000	1.000	Q9Y6J6.pdb.gz	KCNE2_HUMAN Potassium voltage-gated channel subfamily E member 2 OS=Homo sapiens OX=9606 GN=KCNE2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y6J6	8.04e-90	257	123	1.000	1.000	KCNE2_HUMAN Potassium voltage-gated channel subfamily E member 2 OS=Homo sapiens OX=9606 GN=KCNE2 PE=1 SV=1
2	P63161	1.26e-77	226	123	0.821	0.821	KCNE2_RAT Potassium voltage-gated channel subfamily E member 2 OS=Rattus norvegicus OX=10116 GN=Kcne2 PE=1 SV=1
3	Q9D808	3.16e-77	225	123	0.837	0.837	KCNE2_MOUSE Potassium voltage-gated channel subfamily E member 2 OS=Mus musculus OX=10090 GN=Kcne2 PE=1 SV=2
4	Q6FHJ6	5.62e-10	55.1	129	0.187	0.178	Q6FHJ6_HUMAN Potassium voltage-gated channel subfamily E member 1 (Fragment) OS=Homo sapiens OX=9606 GN=KCNE1 PE=1 SV=1
5	P15382	5.87e-10	55.1	129	0.187	0.178	KCNE1_HUMAN Potassium voltage-gated channel subfamily E member 1 OS=Homo sapiens OX=9606 GN=KCNE1 PE=1 SV=1
6	P15383	1.84e-09	53.9	130	0.179	0.169	KCNE1_RAT Potassium voltage-gated channel subfamily E member 1 OS=Rattus norvegicus OX=10116 GN=Kcne1 PE=1 SV=1
7	P23299	1.93e-09	53.9	129	0.179	0.171	KCNE1_MOUSE Potassium voltage-gated channel subfamily E member 1 OS=Mus musculus OX=10090 GN=Kcne1 PE=1 SV=1
8	Q2N1I1	0.043	33.5	99	0.146	0.182	Q2N1I1_HUMAN Cardiac voltage-gated potassium channel accessory subunit isoform 3a (Fragment) OS=Homo sapiens OX=9606 GN=KCNE3 PE=1 SV=1
9	Q6IAE6	0.051	33.5	103	0.146	0.175	Q6IAE6_HUMAN KCNE3 protein OS=Homo sapiens OX=9606 GN=KCNE3 PE=2 SV=1
10	Q9Y6H6	0.051	33.5	103	0.146	0.175	KCNE3_HUMAN Potassium voltage-gated channel subfamily E member 3 OS=Homo sapiens OX=9606 GN=KCNE3 PE=1 SV=1
11	Q9WTW2	0.35	31.2	103	0.146	0.175	KCNE3_MOUSE Potassium voltage-gated channel subfamily E member 3 OS=Mus musculus OX=10090 GN=Kcne3 PE=3 SV=1
12	Q27GU3	0.42	32.0	257	0.146	0.070	Q27GU3_CAEEL MiRP K channel accessory Subunit OS=Caenorhabditis elegans OX=6239 GN=mps-1 PE=4 SV=2
13	Q9JJV7	0.69	30.4	107	0.106	0.121	KCNE3_RAT Potassium voltage-gated channel subfamily E member 3 OS=Rattus norvegicus OX=10116 GN=Kcne3 PE=1 SV=1
14	P39083	1.7	30.4	1007	0.138	0.017	RGA1_YEAST Rho-type GTPase-activating protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RGA1 PE=1 SV=1
15	Q71FD8	2.8	29.3	170	0.179	0.129	Q71FD8_RAT Potassium voltage-gated channel subfamily E regulatory subunit 4 OS=Rattus norvegicus OX=10116 GN=Kcne4 PE=3 SV=1
16	C5H5I1	4.2	29.3	1864	0.195	0.013	C5H5I1_DANRE Plexin B2 OS=Danio rerio OX=7955 GN=plxnB2 PE=1 SV=1
17	F1QBC0	4.2	29.3	1864	0.195	0.013	F1QBC0_DANRE Plexin b2a OS=Danio rerio OX=7955 GN=fk37b01 PE=1 SV=3
18	Q8K2Q0	5.2	28.5	198	0.098	0.061	COMD9_MOUSE COMM domain-containing protein 9 OS=Mus musculus OX=10090 GN=Commd9 PE=1 SV=3
19	Q07171	5.5	28.9	798	0.098	0.015	GELS_DROME Gelsolin OS=Drosophila melanogaster OX=7227 GN=Gel PE=1 SV=2
20	Q9LSS0	6.5	28.5	668	0.106	0.019	LRK17_ARATH L-type lectin-domain containing receptor kinase I.7 OS=Arabidopsis thaliana OX=3702 GN=LECRK17 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02060 ISK_Channel	8.3e-11	53.1	Slow voltage-gated potassium channel
2	PF13965 SID-1_RNA_chan	39	14.2	dsRNA-gated channel SID-1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000290310

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000155840	0.998	Potassium voltage-gated channel subfamily KQT member 1
2	9606.ENSP00000262186	0.995	Potassium voltage-gated channel subfamily H member 2
3	9606.ENSP00000281830	0.931	Potassium voltage-gated channel subfamily E member 4
4	9606.ENSP00000310557	0.910	Potassium voltage-gated channel subfamily E member 3
5	9606.ENSP00000348573	0.888	A-kinase anchor protein 9
6	9606.ENSP00000410257	0.867	Sodium channel protein type 5 subunit alpha
7	9606.ENSP00000252321	0.848	Potassium voltage-gated channel subfamily A member 5
8	9606.ENSP00000243457	0.844	Inward rectifier potassium channel 2
9	9606.ENSP00000361173	0.830	Potassium voltage-gated channel subfamily E regulatory beta subunit 5
10	9606.ENSP00000333496	0.828	Potassium voltage-gated channel subfamily D member 2
11	9606.ENSP00000319591	0.784	Potassium voltage-gated channel subfamily D member 3
12	9606.ENSP00000266376	0.778	Voltage-dependent L-type calcium channel subunit alpha-1C
13	9606.ENSP00000322460	0.759	Sodium channel subunit beta-4
14	9606.ENSP00000420040	0.753	Kv channel-interacting protein 2
15	9606.ENSP00000349588	0.740	Ankyrin-2
16	9606.ENSP00000217381	0.735	Alpha-1-syntrophin
17	9606.ENSP00000262916	0.719	Potassium voltage-gated channel subfamily KQT member 4
18	9606.ENSP00000231498	0.707	Nuclear pore complex protein Nup155
19	9606.ENSP00000261917	0.705	Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4
20	9606.ENSP00000370543	0.703	Sodium/myo-inositol cotransporter

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044325	1.000	transmembrane transporter binding
GO:0015459	1.000	potassium channel regulator activity
GO:0005251	1.000	delayed rectifier potassium channel activity
GO:0005242	1.000	inward rectifier potassium channel activity
GO:0086008	0.730	voltage-gated potassium channel activity involved in cardiac muscle cell action potential repolarization
GO:1902282	0.663	voltage-gated potassium channel activity involved in ventricular cardiac muscle cell action potential repolarization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0032879	0.996	regulation of localization
GO:0001508	0.995	action potential
GO:0098662	0.995	inorganic cation transmembrane transport
GO:0034220	0.995	monoatomic ion transmembrane transport
GO:0006813	0.995	potassium ion transport
GO:0065009	0.993	regulation of molecular function
GO:1904062	0.993	regulation of monoatomic cation transmembrane transport
GO:0043266	0.990	regulation of potassium ion transport
GO:0032501	0.987	multicellular organismal process
GO:0098655	0.987	monoatomic cation transmembrane transport
GO:0071805	0.984	potassium ion transmembrane transport
GO:0050896	0.973	response to stimulus
GO:0060047	0.968	heart contraction
GO:0086001	0.965	cardiac muscle cell action potential
GO:0006941	0.965	striated muscle contraction
GO:0060048	0.964	cardiac muscle contraction
GO:0032412	0.963	regulation of monoatomic ion transmembrane transporter activity
GO:0070252	0.957	actin-mediated cell contraction
GO:0043267	0.953	negative regulation of potassium ion transport
GO:2001257	0.953	regulation of cation channel activity
GO:1904063	0.950	negative regulation of cation transmembrane transport
GO:1901016	0.949	regulation of potassium ion transmembrane transporter activity
GO:0048518	0.939	positive regulation of biological process
GO:0098659	0.921	inorganic cation import across plasma membrane
GO:0140115	0.918	export across plasma membrane
GO:0002027	0.914	regulation of heart rate
GO:0061337	0.913	cardiac conduction
GO:0042221	0.909	response to chemical
GO:0051716	0.853	cellular response to stimulus
GO:0032410	0.821	negative regulation of transporter activity
GO:2001258	0.808	negative regulation of cation channel activity
GO:0019222	0.728	regulation of metabolic process
GO:0060255	0.717	regulation of macromolecule metabolic process
GO:0080090	0.688	regulation of primary metabolic process
GO:0051171	0.688	regulation of nitrogen compound metabolic process
GO:0051246	0.538	regulation of protein metabolic process
GO:0042176	0.494	regulation of protein catabolic process
GO:0070887	0.484	cellular response to chemical stimulus
GO:1903050	0.455	regulation of proteolysis involved in protein catabolic process
GO:0051247	0.440	positive regulation of protein metabolic process
GO:0060306	0.437	regulation of membrane repolarization
GO:0048522	0.427	positive regulation of cellular process
GO:0086003	0.357	cardiac muscle cell contraction
GO:0086002	0.321	cardiac muscle cell action potential involved in contraction
GO:0032502	0.313	developmental process
GO:0099623	0.313	regulation of cardiac muscle cell membrane repolarization
GO:1901380	0.309	negative regulation of potassium ion transmembrane transport
GO:0086005	0.308	ventricular cardiac muscle cell action potential

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008076	1.000	voltage-gated potassium channel complex
GO:0043227	0.998	membrane-bounded organelle
GO:0005737	0.995	cytoplasm
GO:0043231	0.991	intracellular membrane-bounded organelle
GO:0009986	0.800	cell surface
GO:0005773	0.590	vacuole
GO:0000323	0.569	lytic vacuole
GO:0005764	0.555	lysosome
GO:0012505	0.412	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29463	1.000	K(+)(in) = K(+)(out)

[back to server]