StarFunc result for job id Q9Y6J8

User Input

>input (313 residues)
MPGLLLCEPTELYNILNQATKLSRLTDPNYLCLLDVRSKWEYDESHVITALRVKKKNNEY
LLPESVDLECVKYCVVYDNNSSTLEILLKDDDDDSDSDGDGKDLVPQAAIEYGRILTRLT
HHPVYILKGGYERFSGTYHFLRTQKIIWMPQELDAFQPYPIEIVPGKVFVGNFSQACDPK
IQKDLKIKAHVNVSMDTGPFFAGDADKLLHIRIEDSPEAQILPFLRHMCHFIEIHHHLGS
VILIFSTQGISRSCAAIIAYLMHSNEQTLQRSWAYVKKCKNNMCPNRGLVSQLLEWEKTI
LGDSITNIMDPLY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y6J8	1.000	1.000	1.827E-71	313	1.000	1.000	Q9Y6J8.pdb.gz	STYL1_HUMAN Serine/threonine/tyrosine-interacting-like protein 1 OS=Homo sapiens OX=9606 GN=STYXL1 PE=1 SV=1
2	AFDB:A0A024RAR2	0.442	0.210	3.419E-23	665	0.230	0.108	A0A024RAR2.pdb.gz
3	AFDB:Q62767	0.450	0.360	6.412E-22	395	0.236	0.187	Q62767.pdb.gz	DUS4_RAT Dual specificity protein phosphatase 4 OS=Rattus norvegicus OX=10116 GN=Dusp4 PE=1 SV=1
4	AFDB:Q556Y8	0.704	0.473	9.323E-22	476	0.211	0.139	Q556Y8.pdb.gz	DUSPR_DICDI Probable rhodanese domain-containing dual specificity protein phosphatase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0273199 PE=3 SV=1
5	AFDB:A0A2R8QPP3	0.457	0.392	1.124E-21	367	0.243	0.207	A0A2R8QPP3.pdb.gz
6	AFDB:Q91790	0.451	0.385	1.355E-21	369	0.236	0.201	Q91790.pdb.gz	DUS1A_XENLA Dual specificity protein phosphatase 1-A OS=Xenopus laevis OX=8355 GN=dusp1-a PE=1 SV=1
7	AFDB:P28562	0.448	0.384	1.740E-21	367	0.246	0.210	P28562.pdb.gz	DUS1_HUMAN Dual specificity protein phosphatase 1 OS=Homo sapiens OX=9606 GN=DUSP1 PE=1 SV=3
8	AFDB:Q05923	0.451	0.450	1.363E-20	314	0.246	0.245	Q05923.pdb.gz	DUS2_HUMAN Dual specificity protein phosphatase 2 OS=Homo sapiens OX=9606 GN=DUSP2 PE=1 SV=1
9	AFDB:A0A024RBC1	0.444	0.369	1.981E-20	381	0.236	0.194	A0A024RBC1.pdb.gz
10	AFDB:O54838	0.454	0.373	2.244E-20	384	0.240	0.195	O54838.pdb.gz	DUS5_RAT Dual specificity protein phosphatase 5 OS=Rattus norvegicus OX=10116 GN=Dusp5 PE=2 SV=1
11	PDB:6d66A	0.446	0.274	1.355E-14	517	0.137	0.083	6d66A.pdb.gz
12	PDB:2wgpA	0.443	0.805	5.720E-13	168	0.115	0.214	2wgpA.pdb.gz
13	PDB:2esbA	0.453	0.854	1.209E-12	162	0.109	0.210	2esbA.pdb.gz
14	PDB:5y15A	0.424	0.869	8.898E-12	148	0.134	0.284	5y15A.pdb.gz
15	PDB:2gwoC	0.411	0.715	3.528E-10	174	0.115	0.207	2gwoC.pdb.gz
16	PDB:2y96A	0.422	0.736	5.129E-10	175	0.128	0.229	2y96A.pdb.gz
17	PDB:3f81A	0.416	0.709	1.392E-9	179	0.115	0.201	3f81A.pdb.gz	Multidentate small-molecule inhibitors of vaccinia H1-related (VHR) phosphatase decrease proliferation of cervix cancer cells.
18	PDB:5xjvB	0.407	0.722	1.678E-9	171	0.118	0.216	5xjvB.pdb.gz
19	PDB:2q05A	0.355	0.593	6.653E-8	181	0.105	0.182	2q05A.pdb.gz
20	PDB:4rkkA	0.372	0.369	3.584E-7	317	0.083	0.082	4rkkA.pdb.gz	Structural mechanism of laforin function in glycogen dephosphorylation and lafora disease.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y6J8	0.0	653	313	1.000	1.000	STYL1_HUMAN Serine/threonine/tyrosine-interacting-like protein 1 OS=Homo sapiens OX=9606 GN=STYXL1 PE=1 SV=1
2	Q9VVW5	5.42e-16	80.1	411	0.153	0.117	DUSK3_DROME Dual specificity protein phosphatase Mpk3 OS=Drosophila melanogaster OX=7227 GN=Mkp3 PE=1 SV=2
3	P28562	2.60e-14	74.7	367	0.243	0.207	DUS1_HUMAN Dual specificity protein phosphatase 1 OS=Homo sapiens OX=9606 GN=DUSP1 PE=1 SV=3
4	Q7SZF3	3.44e-14	74.3	367	0.179	0.153	Q7SZF3_DANRE Dual specificity protein phosphatase OS=Danio rerio OX=7955 GN=zgc:55423 PE=2 SV=1
5	Q10038	3.80e-14	75.1	657	0.236	0.113	VHP1_CAEEL Tyrosine-protein phosphatase vhp-1 OS=Caenorhabditis elegans OX=6239 GN=vhp-1 PE=1 SV=2
6	Q91790	2.52e-13	72.0	369	0.182	0.154	DUS1A_XENLA Dual specificity protein phosphatase 1-A OS=Xenopus laevis OX=8355 GN=dusp1-a PE=1 SV=1
7	Q64623	5.08e-13	71.2	367	0.236	0.202	DUS1_RAT Dual specificity protein phosphatase 1 OS=Rattus norvegicus OX=10116 GN=Dusp1 PE=1 SV=1
8	D4A3W6	7.53e-13	71.2	661	0.243	0.115	D4A3W6_RAT Dual specificity phosphatase 16 OS=Rattus norvegicus OX=10116 GN=Dusp16 PE=1 SV=1
9	Q05923	8.97e-13	70.1	314	0.179	0.178	DUS2_HUMAN Dual specificity protein phosphatase 2 OS=Homo sapiens OX=9606 GN=DUSP2 PE=1 SV=1
10	Q16690	1.31e-12	70.1	384	0.195	0.159	DUS5_HUMAN Dual specificity protein phosphatase 5 OS=Homo sapiens OX=9606 GN=DUSP5 PE=1 SV=2
11	Q13115	1.45e-12	69.7	394	0.179	0.142	DUS4_HUMAN Dual specificity protein phosphatase 4 OS=Homo sapiens OX=9606 GN=DUSP4 PE=1 SV=1
12	O54838	2.68e-12	68.9	384	0.195	0.159	DUS5_RAT Dual specificity protein phosphatase 5 OS=Rattus norvegicus OX=10116 GN=Dusp5 PE=2 SV=1
13	Q9BY84	2.74e-12	69.7	665	0.230	0.108	DUS16_HUMAN Dual specificity protein phosphatase 16 OS=Homo sapiens OX=9606 GN=DUSP16 PE=1 SV=1
14	Q62767	2.81e-12	68.9	395	0.182	0.144	DUS4_RAT Dual specificity protein phosphatase 4 OS=Rattus norvegicus OX=10116 GN=Dusp4 PE=1 SV=1
15	P28563	3.33e-12	68.6	367	0.233	0.199	DUS1_MOUSE Dual specificity protein phosphatase 1 OS=Mus musculus OX=10090 GN=Dusp1 PE=1 SV=1
16	Q8WUJ0	6.38e-12	66.2	223	0.153	0.215	STYX_HUMAN Serine/threonine/tyrosine-interacting protein OS=Homo sapiens OX=9606 GN=STYX PE=1 SV=1
17	Q556Y8	7.94e-12	67.8	476	0.157	0.103	DUSPR_DICDI Probable rhodanese domain-containing dual specificity protein phosphatase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0273199 PE=3 SV=1
18	Q60969	6.81e-11	63.2	223	0.153	0.215	STYX_MOUSE Serine/threonine/tyrosine-interacting protein OS=Mus musculus OX=10090 GN=Styx PE=1 SV=2
19	Q55CS7	7.65e-11	65.1	834	0.147	0.055	MPL1_DICDI MAP kinase phosphatase with leucine-rich repeats protein 1 OS=Dictyostelium discoideum OX=44689 GN=mpl1 PE=2 SV=1
20	Q8WTR2	3.04e-10	61.2	217	0.118	0.171	DUS19_HUMAN Dual specificity protein phosphatase 19 OS=Homo sapiens OX=9606 GN=DUSP19 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00782 DSPc	1.2e-19	81.9	Dual specificity phosphatase, catalytic domain
2	PF00581 Rhodanese	0.00023	33.0	Rhodanese-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000248600

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377681	0.836	Ras GTPase-activating protein-binding protein 1
2	9606.ENSP00000296091	0.763	Zinc finger protein 502
3	9606.ENSP00000377640	0.638	Ribosomal protein L24
4	9606.ENSP00000259229	0.613	Coiled-coil domain-containing protein 115
5	9606.ENSP00000365160	0.592	Diphosphoinositol polyphosphate phosphohydrolase 3-beta
6	9606.ENSP00000378504	0.574	Nuclear RNA export factor 3
7	9606.ENSP00000374354	0.537	Exosome complex component RRP43
8	9606.ENSP00000295119	0.530	Nucleoporin NUP53
9	9606.ENSP00000296741	0.528	Ectonucleotide pyrophosphatase/phosphodiesterase family member 6
10	9606.ENSP00000264065	0.527	DnaJ homolog subfamily C member 10
11	9606.ENSP00000326267	0.524	EF-hand calcium-binding domain-containing protein 11
12	9606.ENSP00000345055	0.519	Potassium voltage-gated channel subfamily KQT member 5
13	9606.ENSP00000382021	0.517	Leucine carboxyl methyltransferase 1
14	9606.ENSP00000366654	0.512	Carbonic anhydrase 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019902	1.000	phosphatase binding
GO:0016791	1.000	phosphatase activity
GO:0004864	0.999	protein phosphatase inhibitor activity
GO:0004721	0.993	phosphoprotein phosphatase activity
GO:0019903	0.916	protein phosphatase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0065007	0.979	biological regulation
GO:0031323	0.968	regulation of cellular metabolic process
GO:1902531	0.946	regulation of intracellular signal transduction
GO:0080090	0.936	regulation of primary metabolic process
GO:0048522	0.936	positive regulation of cellular process
GO:0048523	0.924	negative regulation of cellular process
GO:0065009	0.915	regulation of molecular function
GO:0023052	0.899	signaling
GO:0051128	0.889	regulation of cellular component organization
GO:0060255	0.885	regulation of macromolecule metabolic process
GO:0019220	0.884	regulation of phosphate metabolic process
GO:0050896	0.878	response to stimulus
GO:0033043	0.875	regulation of organelle organization
GO:0051171	0.859	regulation of nitrogen compound metabolic process
GO:0051716	0.829	cellular response to stimulus
GO:0009892	0.821	negative regulation of metabolic process
GO:0051246	0.816	regulation of protein metabolic process
GO:0031324	0.788	negative regulation of cellular metabolic process
GO:0010639	0.784	negative regulation of organelle organization
GO:1902115	0.752	regulation of organelle assembly
GO:0051172	0.743	negative regulation of nitrogen compound metabolic process
GO:0010605	0.732	negative regulation of macromolecule metabolic process
GO:0007154	0.726	cell communication
GO:0035303	0.718	regulation of dephosphorylation
GO:2001233	0.710	regulation of apoptotic signaling pathway
GO:0045936	0.699	negative regulation of phosphate metabolic process
GO:0031399	0.664	regulation of protein modification process
GO:1902116	0.644	negative regulation of organelle assembly
GO:0044092	0.636	negative regulation of molecular function
GO:0043086	0.626	negative regulation of catalytic activity
GO:0051248	0.612	negative regulation of protein metabolic process
GO:2001242	0.609	regulation of intrinsic apoptotic signaling pathway
GO:0051336	0.603	regulation of hydrolase activity
GO:0010942	0.598	positive regulation of cell death
GO:0035305	0.596	negative regulation of dephosphorylation
GO:0043068	0.591	positive regulation of programmed cell death
GO:0010921	0.591	regulation of phosphatase activity
GO:0008152	0.586	metabolic process
GO:0048584	0.569	positive regulation of response to stimulus
GO:0071704	0.551	organic substance metabolic process
GO:2001235	0.548	positive regulation of apoptotic signaling pathway
GO:1902533	0.539	positive regulation of intracellular signal transduction
GO:0044237	0.510	cellular metabolic process
GO:0035556	0.505	intracellular signal transduction
GO:2001244	0.494	positive regulation of intrinsic apoptotic signaling pathway
GO:0051346	0.493	negative regulation of hydrolase activity
GO:0051130	0.408	positive regulation of cellular component organization
GO:0043170	0.369	macromolecule metabolic process
GO:0031400	0.353	negative regulation of protein modification process
GO:0044238	0.348	primary metabolic process
GO:0006807	0.336	nitrogen compound metabolic process
GO:0010923	0.320	negative regulation of phosphatase activity
GO:0120035	0.310	regulation of plasma membrane bounded cell projection organization
GO:0035304	0.305	regulation of protein dephosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005739	0.911	mitochondrion
GO:0005634	0.901	nucleus
GO:0070013	0.833	intracellular organelle lumen
GO:0031981	0.823	nuclear lumen
GO:0005654	0.814	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.-	1.000	Phosphoric monoester hydrolases.

[back to server]