StarFunc result for job id Q9Y6K0

User Input

>input (416 residues)
MSGHRSTRKRCGDSHPESPVGFGHMSTTGCVLNKLFQLPTPPLSRHQLKRLEEHRYQSAG
RSLLEPLMQGYWEWLVRRVPSWIAPNLITIIGLSINICTTILLVFYCPTATEQAPLWAYI
ACACGLFIYQSLDAIDGKQARRTNSSSPLGELFDHGCDSLSTVFVVLGTCIAVQLGTNPD
WMFFCCFAGTFMFYCAHWQTYVSGTLRFGIIDVTEVQIFIIIMHLLAVIGGPPFWQSMIP
VLNIQMKIFPALCTVAGTIFSCTNYFRVIFTGGVGKNGSTIAGTSVLSPFLHIGSVITLA
AMIYKKSAVQLFEKHPCLYILTFGFVSAKITNKLVVAHMTKSEMHLHDTAFIGPALLFLD
QYFNSFIDEYIVLWIALVFSFFDLIRYCVSVCNQIASHLHIHVFRIKVSTAHSNHH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BGS7	0.938	0.938	5.851E-56	416	0.986	0.986	Q8BGS7.pdb.gz	CEPT1_MOUSE Choline/ethanolaminephosphotransferase 1 OS=Mus musculus OX=10090 GN=Cept1 PE=1 SV=1
2	AFDB:Q8C025	0.886	0.925	1.268E-42	398	0.601	0.628	Q8C025.pdb.gz	CHPT1_MOUSE Cholinephosphotransferase 1 OS=Mus musculus OX=10090 GN=Chpt1 PE=1 SV=1
3	AFDB:Q8WUD6	0.874	0.895	1.324E-42	406	0.601	0.616	Q8WUD6.pdb.gz	CHPT1_HUMAN Cholinephosphotransferase 1 OS=Homo sapiens OX=9606 GN=CHPT1 PE=1 SV=1
4	AFDB:A0A0B4K7Y4	0.887	0.885	1.632E-36	417	0.474	0.472	A0A0B4K7Y4.pdb.gz	A0A0B4K7Y4_DROME Bb in a boxcar, isoform C OS=Drosophila melanogaster OX=7227 GN=bbc PE=1 SV=1
5	AFDB:O82567	0.797	0.850	4.284E-20	389	0.255	0.272	O82567.pdb.gz	AAPT1_ARATH Choline/ethanolaminephosphotransferase 1 OS=Arabidopsis thaliana OX=3702 GN=AAPT1 PE=1 SV=1
6	AFDB:Q38A84	0.777	0.749	8.601E-20	432	0.248	0.238	Q38A84.pdb.gz	Q38A84_TRYB2 Ethanolaminephosphotransferase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.1570 PE=3 SV=1
7	AFDB:Q8T0S3	0.811	0.812	8.601E-20	415	0.231	0.231	Q8T0S3.pdb.gz	Q8T0S3_DROME GH11618p OS=Drosophila melanogaster OX=7227 GN=dCCS3 PE=2 SV=1
8	AFDB:Q9VIU4	0.777	0.758	1.174E-18	427	0.221	0.215	Q9VIU4.pdb.gz	Q9VIU4_DROME FI05338p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG33116 PE=1 SV=2
9	AFDB:O13901	0.730	0.783	1.895E-18	386	0.267	0.288	O13901.pdb.gz	YF3A_SCHPO Uncharacterized CDP-alcohol phosphatidyltransferase class-I family protein C22A12.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC22A12.10 PE=3 SV=1
10	AFDB:P22140	0.769	0.815	1.757E-16	391	0.209	0.223	P22140.pdb.gz	EPT1_YEAST Choline/ethanolaminephosphotransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EPT1 PE=1 SV=2
11	PDB:8cs9Q	0.230	0.241	5.287E-2	390	0.075	0.079	8cs9Q.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
12	PDB:3uonA	0.154	0.148	6.573E-2	438	0.113	0.107	3uonA.pdb.gz	Structure of the human M2 muscarinic acetylcholine receptor bound to an antagonist.
13	PDB:5yqzR	0.113	0.093	1.263E-1	558	0.108	0.081	5yqzR.pdb.gz	Structure of the glucagon receptor in complex with a glucagon analogue.
14	PDB:3v2yA	0.145	0.137	1.504E-1	455	0.130	0.119	3v2yA.pdb.gz	Crystal structure of a lipid G protein-coupled receptor.
15	PDB:7o37C	0.140	0.150	1.504E-1	380	0.139	0.153	7o37C.pdb.gz	Structure and assembly of the mammalian mitochondrial supercomplex CIII 2 CIV.
16	PDB:6l7oD	0.136	0.119	1.790E-1	504	0.125	0.103	6l7oD.pdb.gz	Structural insights into NDH-1 mediated cyclic electron transfer.
17	PDB:4k5yC	0.197	0.282	1.870E-1	248	0.075	0.125	4k5yC.pdb.gz	Structure of class B GPCR corticotropin-releasing factor receptor 1.
18	PDB:1be3C	0.146	0.155	2.040E-1	379	0.120	0.132	1be3C.pdb.gz	Complete structure of the 11-subunit bovine mitochondrial cytochrome bc1 complex.
19	PDB:3cx5C	0.174	0.185	2.649E-1	385	0.139	0.151	3cx5C.pdb.gz	Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
20	PDB:7uzqK	0.236	0.251	3.019E-1	380	0.089	0.097	7uzqK.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BGS7	0.0	850	416	0.986	0.986	CEPT1_MOUSE Choline/ethanolaminephosphotransferase 1 OS=Mus musculus OX=10090 GN=Cept1 PE=1 SV=1
2	Q8C025	0.0	532	398	0.594	0.621	CHPT1_MOUSE Cholinephosphotransferase 1 OS=Mus musculus OX=10090 GN=Chpt1 PE=1 SV=1
3	Q8WUD6	0.0	524	406	0.584	0.599	CHPT1_HUMAN Cholinephosphotransferase 1 OS=Homo sapiens OX=9606 GN=CHPT1 PE=1 SV=1
4	Q9Y6K0	0.0	860	416	1.000	1.000	CEPT1_HUMAN Choline/ethanolaminephosphotransferase 1 OS=Homo sapiens OX=9606 GN=CEPT1 PE=1 SV=1
5	A0A0B4K7Y4	2.08e-142	414	417	0.474	0.472	A0A0B4K7Y4_DROME Bb in a boxcar, isoform C OS=Drosophila melanogaster OX=7227 GN=bbc PE=1 SV=1
6	O82567	5.38e-42	154	389	0.272	0.290	AAPT1_ARATH Choline/ethanolaminephosphotransferase 1 OS=Arabidopsis thaliana OX=3702 GN=AAPT1 PE=1 SV=1
7	O13901	1.53e-36	139	386	0.267	0.288	YF3A_SCHPO Uncharacterized CDP-alcohol phosphatidyltransferase class-I family protein C22A12.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC22A12.10 PE=3 SV=1
8	Q38A84	1.35e-35	137	432	0.276	0.266	Q38A84_TRYB2 Ethanolaminephosphotransferase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.1570 PE=3 SV=1
9	Q8T0S3	3.96e-32	128	415	0.248	0.248	Q8T0S3_DROME GH11618p OS=Drosophila melanogaster OX=7227 GN=dCCS3 PE=2 SV=1
10	P17898	2.44e-29	119	393	0.250	0.265	CPT1_YEAST Cholinephosphotransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CPT1 PE=1 SV=3
11	P22140	2.95e-28	116	391	0.197	0.210	EPT1_YEAST Choline/ethanolaminephosphotransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EPT1 PE=1 SV=2
12	Q9C0D9	1.51e-27	115	397	0.243	0.254	EPT1_HUMAN Ethanolaminephosphotransferase 1 OS=Homo sapiens OX=9606 GN=SELENOI PE=1 SV=3
13	Q9VIU4	6.61e-27	113	427	0.147	0.143	Q9VIU4_DROME FI05338p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG33116 PE=1 SV=2
14	Q59M00	2.36e-25	108	402	0.151	0.157	Q59M00_CANAL Bifunctional diacylglycerol cholinephosphotransferase/ethanolaminephosphotransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=EPT1 PE=3 SV=1
15	Q8WU57	3.67e-24	102	258	0.159	0.256	Q8WU57_HUMAN SELI protein OS=Homo sapiens OX=9606 GN=SELI PE=1 SV=1
16	Q388W5	3.62e-06	51.2	506	0.094	0.077	Q388W5_TRYB2 ethanolamine-phosphate cytidylyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.0730 PE=3 SV=1
17	Q4QDW1	0.004	41.6	415	0.087	0.087	Q4QDW1_LEIMA Putative ethanolamine phosphotransferase OS=Leishmania major OX=5664 GN=LMJF_18_0810 PE=3 SV=1
18	C0H5B7	0.045	37.4	209	0.043	0.086	C0H5B7_PLAF7 CDP-diacylglycerol--inositol 3-phosphatidyltransferase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1315600 PE=3 SV=1
19	P9WPG7	0.054	37.4	217	0.046	0.088	PIPS_MYCTU Phosphatidylinositol phosphate synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pgsA1 PE=1 SV=1
20	Q388R8	0.076	37.7	412	0.046	0.046	Q388R8_TRYB2 Ethanolamine phosphotransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.0140 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01066 CDP-OH_P_transf	6e-09	48.0	CDP-alcohol phosphatidyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000441980

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000292823	0.983	Choline-phosphate cytidylyltransferase A
2	9606.ENSP00000368439	0.981	Choline-phosphate cytidylyltransferase B
3	9606.ENSP00000442050	0.979	Ethanolamine-phosphate cytidylyltransferase
4	9606.ENSP00000255389	0.966	Phosphatidylethanolamine N-methyltransferase
5	9606.ENSP00000371586	0.965	Phosphatidylserine decarboxylase proenzyme, mitochondrial
6	9606.ENSP00000324944	0.960	Lysophospholipid acyltransferase 1
7	9606.ENSP00000261407	0.955	Lysophospholipid acyltransferase 5
8	9606.ENSP00000262134	0.953	Lysophosphatidylcholine acyltransferase 2
9	9606.ENSP00000302177	0.948	Lysophospholipid acyltransferase 2
10	9606.ENSP00000308258	0.948	Phosphatidylserine synthase 2
11	9606.ENSP00000430548	0.946	Phosphatidylserine synthase 1
12	9606.ENSP00000283415	0.938	Lysophosphatidylcholine acyltransferase 1
13	9606.ENSP00000317300	0.936	Lysophospholipid acyltransferase LPCAT4
14	9606.ENSP00000320337	0.935	HRAS-like suppressor 3
15	9606.ENSP00000342793	0.928	Phospholipase D1
16	9606.ENSP00000264005	0.927	Phosphatidylcholine-sterol acyltransferase
17	9606.ENSP00000263088	0.926	Phospholipase D2
18	9606.ENSP00000360296	0.924	Phospholipid phosphatase 3
19	9606.ENSP00000260585	0.921	Ethanolaminephosphotransferase 1
20	9606.ENSP00000381302	0.908	Phospholipid phosphatase 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016780	1.000	phosphotransferase activity, for other substituted phosphate groups
GO:0005515	0.969	protein binding
GO:0017169	0.928	CDP-alcohol phosphatidyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0006650	0.987	glycerophospholipid metabolic process
GO:1901564	0.982	organonitrogen compound metabolic process
GO:0046474	0.978	glycerophospholipid biosynthetic process
GO:0046470	0.974	phosphatidylcholine metabolic process
GO:0006656	0.771	phosphatidylcholine biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	0.995	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.8.-	1.000	Transferases for other substituted phosphate groups.

[back to server]