StarFunc result for job id Q9Y6K1

User Input

>input (912 residues)
MPAMPSSGPGDTSSSAAEREEDRKDGEEQEEPRGKEERQEPSTTARKVGRPGRKRKHPPV
ESGDTPKDPAVISKSPSMAQDSGASELLPNGDLEKRSEPQPEEGSPAGGQKGGAPAEGEG
AAETLPEASRAVENGCCTPKEGRGAPAEAGKEQKETNIESMKMEGSRGRLRGGLGWESSL
RQRPMPRLTFQAGDPYYISKRKRDEWLARWKREAEKKAKVIAGMNAVEENQGPGESQKVE
EASPPAVQQPTDPASPTVATTPEPVGSDAGDKNATKAGDDEPEYEDGRGFGIGELVWGKL
RGFSWWPGRIVSWWMTGRSRAAEGTRWVMWFGDGKFSVVCVEKLMPLSSFCSAFHQATYN
KQPMYRKAIYEVLQVASSRAGKLFPVCHDSDESDTAKAVEVQNKPMIEWALGGFQPSGPK
GLEPPEEEKNPYKEVYTDMWVEPEAAAYAPPPPAKKPRKSTAEKPKVKEIIDERTRERLV
YEVRQKCRNIEDICISCGSLNVTLEHPLFVGGMCQNCKNCFLECAYQYDDDGYQSYCTIC
CGGREVLMCGNNNCCRCFCVECVDLLVGPGAAQAAIKEDPWNCYMCGHKGTYGLLRRRED
WPSRLQMFFANNHDQEFDPPKVYPPVPAEKRKPIRVLSLFDGIATGLLVLKDLGIQVDRY
IASEVCEDSITVGMVRHQGKIMYVGDVRSVTQKHIQEWGPFDLVIGGSPCNDLSIVNPAR
KGLYEGTGRLFFEFYRLLHDARPKEGDDRPFFWLFENVVAMGVSDKRDISRFLESNPVMI
DAKEVSAAHRARYFWGNLPGMNRPLASTVNDKLELQECLEHGRIAKFSKVRTITTRSNSI
KQGKDQHFPVFMNEKEDILWCTEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRH
LFAPLKEYFACV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y6K1	1.000	1.000	0.000	912	1.000	1.000	Q9Y6K1.pdb.gz	DNM3A_HUMAN DNA (cytosine-5)-methyltransferase 3A OS=Homo sapiens OX=9606 GN=DNMT3A PE=1 SV=4
2	AFDB:O88509	0.482	0.512	1.968E-95	859	0.478	0.508	O88509.pdb.gz	DNM3B_MOUSE DNA (cytosine-5)-methyltransferase 3B OS=Mus musculus OX=10090 GN=Dnmt3b PE=1 SV=2
3	AFDB:Q9UJW3	0.306	0.658	9.920E-33	386	0.158	0.373	Q9UJW3.pdb.gz	DNM3L_HUMAN DNA (cytosine-5)-methyltransferase 3-like OS=Homo sapiens OX=9606 GN=DNMT3L PE=1 SV=3
4	PDB:2pv0B	0.303	0.698	1.230E-28	347	0.156	0.409	2pv0B.pdb.gz	DNMT3L connects unmethylated lysine 4 of histone H3 to de novo methylation of DNA.
5	PDB:6pa7N	0.203	0.825	2.366E-23	211	0.188	0.810	6pa7N.pdb.gz	Structure of nucleosome-bound DNA methyltransferases DNMT3A and DNMT3B.
6	PDB:6fdfA	0.236	0.605	2.676E-11	325	0.060	0.169	6fdfA.pdb.gz	Structural insights into the stimulation of S. pombe Dnmt2 catalytic efficiency by the tRNA nucleoside queuosine.
7	PDB:7r78A	0.223	0.113	3.918E-8	1880	0.060	0.029	7r78A.pdb.gz	Structural insights into DNMT5-mediated ATP-dependent high-fidelity epigenome maintenance.
8	PDB:7r76A	0.221	0.114	9.086E-8	1834	0.060	0.030	7r76A.pdb.gz	Structural insights into DNMT5-mediated ATP-dependent high-fidelity epigenome maintenance.
9	PDB:7t02A	0.205	0.111	2.636E-7	1752	0.055	0.029	7t02A.pdb.gz	Structural insights into DNMT5-mediated ATP-dependent high-fidelity epigenome maintenance.
10	PDB:6h2vA	0.127	0.437	5.128E-5	210	0.032	0.138	6h2vA.pdb.gz	The human 18S rRNA m6A methyltransferase METTL5 is stabilized by TRMT112.
11	AFDB:A0A5F9ZH11	0.089	0.067	8.444E-5	1253	0.078	0.057	A0A5F9ZH11.pdb.gz	A0A5F9ZH11_HUMAN Bromodomain and PHD finger containing 1 OS=Homo sapiens OX=9606 GN=BRPF1 PE=1 SV=2
12	PDB:2b3tA	0.123	0.347	3.084E-4	276	0.027	0.091	2b3tA.pdb.gz	Molecular basis for bacterial class I release factor methylation by PrmC
13	PDB:2bh2A	0.120	0.237	3.084E-4	418	0.029	0.062	2bh2A.pdb.gz	A Unique RNA Fold in the Ruma-RNA-Cofactor Ternary Complex Contributes to Substrate Selectivity and Enzymatic Function
14	PDB:2xvaA	0.123	0.450	3.262E-4	199	0.027	0.126	2xvaA.pdb.gz	Structure and Mechanism of the Chalcogen Detoxifying Protein Tehb from Escherichia Coli.
15	AFDB:Q7JVP4	0.072	0.050	4.523E-3	1430	0.093	0.059	Q7JVP4.pdb.gz	BRDH_DROME Bromodomain-containing protein homolog OS=Drosophila melanogaster OX=7227 GN=Br140 PE=1 SV=1
16	AFDB:Q96L73	0.081	0.032	5.351E-3	2696	0.073	0.025	Q96L73.pdb.gz	NSD1_HUMAN Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Homo sapiens OX=9606 GN=NSD1 PE=1 SV=1
17	AFDB:Q584W1	0.038	0.056	2.055E-2	492	0.060	0.112	Q584W1.pdb.gz	Q584W1_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.2N9.880 PE=4 SV=1
18	AFDB:Q9VVI3	0.042	0.039	3.601E-2	1007	0.061	0.056	Q9VVI3.pdb.gz	NEDD4_DROME E3 ubiquitin-protein ligase Nedd-4 OS=Drosophila melanogaster OX=7227 GN=Nedd4 PE=1 SV=2
19	AFDB:Q8RWK8	0.052	0.067	1.169E-1	608	0.066	0.099	Q8RWK8.pdb.gz	COIL_ARATH Coilin OS=Arabidopsis thaliana OX=3702 GN=COIL PE=1 SV=1
20	AFDB:Q9XYD3	0.049	0.047	1.636E-1	982	0.060	0.056	Q9XYD3.pdb.gz	HBL1_CAEEL Hunchback-like protein OS=Caenorhabditis elegans OX=6239 GN=hbl-1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JYR2	0.0	650	796	0.350	0.401	A0A0G2JYR2_RAT DNA (cytosine-5-)-methyltransferase OS=Rattus norvegicus OX=10116 GN=Dnmt3b PE=3 SV=2
2	A0A2R9YJL5	0.0	786	1456	0.410	0.257	A0A2R9YJL5_DANRE DNA (cytosine-5-)-methyltransferase OS=Danio rerio OX=7955 GN=cb91 PE=1 SV=1
3	A0A8I6AVL3	0.0	835	839	0.438	0.476	A0A8I6AVL3_RAT DNA (cytosine-5-)-methyltransferase OS=Rattus norvegicus OX=10116 GN=Dnmt3b PE=3 SV=1
4	A0A8J8XG14	0.0	824	860	0.439	0.465	A0A8J8XG14_RAT DNA (cytosine-5-)-methyltransferase OS=Rattus norvegicus OX=10116 GN=Dnmt3b PE=3 SV=1
5	B0S581	0.0	786	1433	0.410	0.261	B0S581_DANRE DNA (cytosine-5-)-methyltransferase OS=Danio rerio OX=7955 GN=cb91 PE=1 SV=1
6	O88508	0.0	1813	908	0.959	0.964	DNM3A_MOUSE DNA (cytosine-5)-methyltransferase 3A OS=Mus musculus OX=10090 GN=Dnmt3a PE=1 SV=2
7	O88509	0.0	834	859	0.444	0.471	DNM3B_MOUSE DNA (cytosine-5)-methyltransferase 3B OS=Mus musculus OX=10090 GN=Dnmt3b PE=1 SV=2
8	P0DOY1	0.0	714	740	0.377	0.465	DNM3C_MOUSE DNA (cytosine-5)-methyltransferase 3C OS=Mus musculus OX=10090 GN=Dnmt3c PE=1 SV=2
9	Q1LZ51	0.0	828	859	0.439	0.466	Q1LZ51_RAT DNA (cytosine-5-)-methyltransferase OS=Rattus norvegicus OX=10116 GN=Dnmt3b PE=2 SV=1
10	Q1LZ53	0.0	1769	908	0.957	0.961	DNM3A_RAT DNA (cytosine-5)-methyltransferase 3A OS=Rattus norvegicus OX=10116 GN=Dnmt3a PE=1 SV=1
11	Q4W5Z4	0.0	1508	877	0.831	0.864	DNM3A_CHICK DNA (cytosine-5)-methyltransferase 3A OS=Gallus gallus OX=9031 GN=DNMT3A PE=2 SV=1
12	Q588C6	0.0	892	816	0.481	0.538	Q588C6_DANRE DNA (cytosine-5-)-methyltransferase OS=Danio rerio OX=7955 GN=cb633 PE=1 SV=1
13	Q588C7	0.0	687	1448	0.383	0.241	Q588C7_DANRE DNA (cytosine-5-)-methyltransferase OS=Danio rerio OX=7955 GN=dnmt3 PE=1 SV=1
14	Q9UBC3	0.0	831	853	0.438	0.468	DNM3B_HUMAN DNA (cytosine-5)-methyltransferase 3B OS=Homo sapiens OX=9606 GN=DNMT3B PE=1 SV=1
15	Q9Y6K1	0.0	1887	912	1.000	1.000	DNM3A_HUMAN DNA (cytosine-5)-methyltransferase 3A OS=Homo sapiens OX=9606 GN=DNMT3A PE=1 SV=4
16	Q9UJW3	3.88e-75	253	386	0.150	0.355	DNM3L_HUMAN DNA (cytosine-5)-methyltransferase 3-like OS=Homo sapiens OX=9606 GN=DNMT3L PE=1 SV=3
17	Q1LZ50	3.14e-70	241	422	0.140	0.303	DNM3L_RAT DNA (cytosine-5)-methyltransferase 3-like OS=Rattus norvegicus OX=10116 GN=Dnmt3l PE=2 SV=1
18	Q9CWR8	7.19e-69	237	421	0.140	0.304	DNM3L_MOUSE DNA (cytosine-5)-methyltransferase 3-like OS=Mus musculus OX=10090 GN=Dnmt3l PE=1 SV=1
19	Q6NUJ5	8.90e-11	68.2	590	0.038	0.059	PWP2B_HUMAN PWWP domain-containing protein 2B OS=Homo sapiens OX=9606 GN=PWWP2B PE=1 SV=3
20	E9Q9M8	1.49e-10	67.4	600	0.039	0.060	PWP2B_MOUSE PWWP domain-containing protein 2B OS=Mus musculus OX=10090 GN=Pwwp2b PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17980 ADD_DNMT3	3.7e-23	92.6	Cysteine rich ADD domain in DNMT3
2	PF00145 DNA_methylase	1.4e-12	59.2	C-5 cytosine-specific DNA methylase
3	PF00855 PWWP	3.8e-08	45.1	PWWP domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264709

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000352516	0.998	DNA (cytosine-5)-methyltransferase 1
2	9606.ENSP00000476960	0.998	Histone cluster 2 H3 pseudogene 2
3	9606.ENSP00000479618	0.998	Myc proto-oncogene protein
4	9606.ENSP00000270172	0.997	DNA (cytosine-5)-methyltransferase 3-like
5	9606.ENSP00000320147	0.997	Histone-lysine N-methyltransferase EZH2
6	9606.ENSP00000362649	0.993	Histone deacetylase 1
7	9606.ENSP00000271640	0.992	Histone-lysine N-methyltransferase SETDB1
8	9606.ENSP00000364678	0.989	Histone-lysine N-methyltransferase EHMT2
9	9606.ENSP00000269397	0.988	E3 SUMO-protein ligase CBX4
10	9606.ENSP00000479617	0.984	E3 ubiquitin-protein ligase UHRF1
11	9606.ENSP00000328547	0.982	DNA (cytosine-5)-methyltransferase 3B
12	9606.ENSP00000355388	0.981	M-phase phosphoprotein 8
13	9606.ENSP00000364885	0.981	Zinc finger and BTB domain-containing protein 17
14	9606.ENSP00000269305	0.979	Cellular tumor antigen p53
15	9606.ENSP00000376611	0.979	G/T mismatch-specific thymine DNA glycosylase
16	9606.ENSP00000366347	0.972	Homeobox protein Nkx-2.2
17	9606.ENSP00000319169	0.970	Protein arginine N-methyltransferase 5
18	9606.ENSP00000480826	0.953	Histone cluster 1 H3 family member a
19	9606.ENSP00000348056	0.948	SUMO-conjugating enzyme UBC9
20	9606.ENSP00000254810	0.942	H3 histone, family 3B (H3.3B)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003682	0.999	chromatin binding
GO:0003886	0.998	DNA (cytosine-5-)-methyltransferase activity
GO:0000976	0.997	transcription cis-regulatory region binding
GO:0140096	0.995	catalytic activity, acting on a protein
GO:0008134	0.977	transcription factor binding
GO:0140110	0.975	transcription regulator activity
GO:0140297	0.951	DNA-binding transcription factor binding
GO:0003712	0.936	transcription coregulator activity
GO:0061629	0.933	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0000978	0.928	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0042802	0.918	identical protein binding
GO:0003714	0.908	transcription corepressor activity
GO:0001046	0.681	core promoter sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0071704	0.976	organic substance metabolic process
GO:0050896	0.975	response to stimulus
GO:0044238	0.956	primary metabolic process
GO:0006807	0.950	nitrogen compound metabolic process
GO:0044237	0.950	cellular metabolic process
GO:0019219	0.939	regulation of nucleobase-containing compound metabolic process
GO:0043412	0.935	macromolecule modification
GO:0006304	0.917	DNA modification
GO:0032501	0.916	multicellular organismal process
GO:0010468	0.915	regulation of gene expression
GO:0006306	0.910	DNA methylation
GO:0010556	0.861	regulation of macromolecule biosynthetic process
GO:0031326	0.860	regulation of cellular biosynthetic process
GO:0048519	0.859	negative regulation of biological process
GO:0051252	0.859	regulation of RNA metabolic process
GO:0048523	0.854	negative regulation of cellular process
GO:0006355	0.837	regulation of DNA-templated transcription
GO:0006325	0.823	chromatin organization
GO:0010033	0.736	response to organic substance
GO:0010605	0.706	negative regulation of macromolecule metabolic process
GO:0051172	0.698	negative regulation of nitrogen compound metabolic process
GO:0031324	0.698	negative regulation of cellular metabolic process
GO:0006357	0.693	regulation of transcription by RNA polymerase II
GO:0045934	0.672	negative regulation of nucleobase-containing compound metabolic process
GO:0051253	0.662	negative regulation of RNA metabolic process
GO:0010558	0.658	negative regulation of macromolecule biosynthetic process
GO:0031327	0.657	negative regulation of cellular biosynthetic process
GO:0045892	0.654	negative regulation of DNA-templated transcription
GO:0048518	0.613	positive regulation of biological process
GO:0032776	0.585	DNA methylation on cytosine
GO:0009628	0.580	response to abiotic stimulus
GO:0048522	0.556	positive regulation of cellular process
GO:0032502	0.489	developmental process
GO:0051716	0.482	cellular response to stimulus
GO:0006950	0.477	response to stress
GO:0000122	0.477	negative regulation of transcription by RNA polymerase II
GO:0048856	0.451	anatomical structure development
GO:0009893	0.318	positive regulation of metabolic process
GO:0010604	0.310	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.999	cytoplasm
GO:0043232	0.993	intracellular non-membrane-bounded organelle
GO:0005694	0.966	chromosome
GO:0032991	0.932	protein-containing complex
GO:0000785	0.912	chromatin
GO:1902494	0.617	catalytic complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:13681	0.998	a 2'-deoxycytidine in DNA + S-adenosyl-L-methionine = a 5-methyl-2'-deoxycytidine in DNA + H(+) + S-adenosyl-L-homocysteine
EC:2.1.1.37	0.998	DNA (cytosine-5-)-methyltransferase.

[back to server]