StarFunc result for job id Q9Y6K5

User Input

>input (1087 residues)
MDLYSTPAAALDRFVARRLQPRKEFVEKARRALGALAAALRERGGRLGAAAPRVLKTVKG
GSSGRGTALKGGCDSELVIFLDCFKSYVDQRARRAEILSEMRASLESWWQNPVPGLRLTF
PEQSVPGALQFRLTSVDLEDWMDVSLVPAFNVLGQAGSGVKPKPQVYSTLLNSGCQGGEH
AACFTELRRNFVNIRPAKLKNLILLVKHWYHQVCLQGLWKETLPPVYALELLTIFAWEQG
CKKDAFSLAEGLRTVLGLIQQHQHLCVFWTVNYGFEDPAVGQFLQRQLKRPRPVILDPAD
PTWDLGNGAAWHWDLLAQEAASCYDHPCFLRGMGDPVQSWKGPGLPRAGCSGLGHPIQLD
PNQKTPENSKSLNAVYPRAGSKPPSCPAPGPTGAASIVPSVPGMALDLSQIPTKELDRFI
QDHLKPSPQFQEQVKKAIDIILRCLHENCVHKASRVSKGGSFGRGTDLRDGCDVELIIFL
NCFTDYKDQGPRRAEILDEMRAQLESWWQDQVPSLSLQFPEQNVPEALQFQLVSTALKSW
TDVSLLPAFDAVGQLSSGTKPNPQVYSRLLTSGCQEGEHKACFAELRRNFMNIRPVKLKN
LILLVKHWYRQVAAQNKGKGPAPASLPPAYALELLTIFAWEQGCRQDCFNMAQGFRTVLG
LVQQHQQLCVYWTVNYSTEDPAMRMHLLGQLRKPRPLVLDPADPTWNVGHGSWELLAQEA
AALGMQACFLSRDGTSVQPWDVMPALLYQTPAGDLDKFISEFLQPNRQFLAQVNKAVDTI
CSFLKENCFRNSPIKVIKVVKGGSSAKGTALRGRSDADLVVFLSCFSQFTEQGNKRAEII
SEIRAQLEACQQERQFEVKFEVSKWENPRVLSFSLTSQTMLDQSVDFDVLPAFDALGQLV
SGSRPSSQVYVDLIHSYSNAGEYSTCFTELQRDFIISRPTKLKSLIRLVKHWYQQCTKIS
KGRGSLPPQHGLELLTVYAWEQGGKDSQFNMAEGFRTVLELVTQYRQLCIYWTINYNAKD
KTVGDFLKQQLQKPRPIILDPADPTGNLGHNARWDLLAKEAAACTSALCCMGRNGIPIQP
WPVKAAV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8VI93	0.764	0.732	0.000	1138	0.706	0.674	Q8VI93.pdb.gz	OAS3_MOUSE 2'-5'-oligoadenylate synthase 3 OS=Mus musculus OX=10090 GN=Oas3 PE=1 SV=1
2	AFDB:Q9Y6K5	1.000	1.000	0.000	1087	1.000	1.000	Q9Y6K5.pdb.gz	OAS3_HUMAN 2'-5'-oligoadenylate synthase 3 OS=Homo sapiens OX=9606 GN=OAS3 PE=1 SV=3
3	AFDB:F1N3B8	0.574	0.859	1.521E-71	714	0.300	0.457	F1N3B8.pdb.gz	OAS2_BOVIN 2'-5'-oligoadenylate synthase 2 OS=Bos taurus OX=9913 GN=OAS2 PE=2 SV=1
4	AFDB:Q5MYU0	0.573	0.837	2.618E-69	733	0.298	0.442	Q5MYU0.pdb.gz	OAS2_RAT 2'-5'-oligoadenylate synthase 2 OS=Rattus norvegicus OX=10116 GN=Oas2 PE=2 SV=1
5	AFDB:E9Q9A9	0.522	0.737	9.965E-69	742	0.304	0.445	E9Q9A9.pdb.gz	OAS2_MOUSE 2'-5'-oligoadenylate synthase 2 OS=Mus musculus OX=10090 GN=Oas2 PE=1 SV=1
6	AFDB:P29728	0.531	0.773	2.610E-65	719	0.295	0.446	P29728.pdb.gz	OAS2_HUMAN 2'-5'-oligoadenylate synthase 2 OS=Homo sapiens OX=9606 GN=OAS2 PE=1 SV=3
7	AFDB:G3SFB1	0.307	0.796	4.756E-40	414	0.191	0.502	G3SFB1.pdb.gz	G3SFB1_GORGO 2'-5' oligoadenylate synthase OS=Gorilla gorilla gorilla OX=9595 GN=OAS1 PE=3 SV=2
8	AFDB:P00973	0.306	0.822	1.560E-39	400	0.190	0.517	P00973.pdb.gz	OAS1_HUMAN 2'-5'-oligoadenylate synthase 1 OS=Homo sapiens OX=9606 GN=OAS1 PE=1 SV=4
9	AFDB:Q3ZM02	0.305	0.714	1.679E-38	459	0.189	0.447	Q3ZM02.pdb.gz	Q3ZM02_HUMAN 2'-5' oligoadenylate synthase OS=Homo sapiens OX=9606 GN=OAS1 PE=2 SV=1
10	AFDB:Q29599	0.305	0.932	3.196E-38	349	0.179	0.559	Q29599.pdb.gz	OAS1_PIG 2'-5'-oligoadenylate synthase 1 OS=Sus scrofa OX=9823 GN=OAS1 PE=1 SV=3
11	PDB:4rwnA	0.297	0.886	2.135E-35	349	0.178	0.556	4rwnA.pdb.gz	The Activation Mechanism of 2'-5'-Oligoadenylate Synthetase Gives New Insights Into OAS/cGAS Triggers of Innate Immunity.
12	PDB:5wyjCB	0.199	0.197	4.990E-12	1098	0.095	0.094	5wyjCB.pdb.gz	Molecular architecture of the 90S small subunit pre-ribosome.
13	PDB:7mq8NH	0.214	0.218	3.991E-11	1066	0.104	0.106	7mq8NH.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:4atbA	0.175	0.475	2.678E-7	334	0.053	0.174	4atbA.pdb.gz	NF45 Dimerizes with NF90, Zfr and Spnr Via a Conserved Domain that Has a Nucleotidyltransferase Fold.
15	PDB:4ud5B	0.190	0.524	3.264E-7	342	0.057	0.181	4ud5B.pdb.gz
16	PDB:4e7xD	0.183	0.545	9.230E-7	320	0.052	0.175	4e7xD.pdb.gz
17	PDB:3c66A	0.205	0.386	9.454E-6	529	0.041	0.085	3c66A.pdb.gz	Structure of yeast poly(A) polymerase in complex with a peptide from Fip1, an intrinsically disordered protein.
18	PDB:3hj1B	0.131	0.324	4.386E-5	387	0.030	0.085	3hj1B.pdb.gz	Structure of the Mitochondrial Editosome-Like Complex Associated TUTase 1 Reveals Divergent Mechanisms of UTP Selection and Domain Organization.
19	PDB:7lt2A	0.179	0.440	7.561E-5	387	0.042	0.119	7lt2A.pdb.gz	cGAS-like receptors sense RNA and control 3'2'-cGAMP signalling in Drosophila.
20	PDB:2q0cB	0.181	0.530	1.180E-4	311	0.040	0.141	2q0cB.pdb.gz	Dual role of the RNA substrate in selectivity and catalysis by terminal uridylyl transferases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9Q9A9	0.0	587	742	0.305	0.446	OAS2_MOUSE 2'-5'-oligoadenylate synthase 2 OS=Mus musculus OX=10090 GN=Oas2 PE=1 SV=1
2	F1N3B8	0.0	606	714	0.300	0.457	OAS2_BOVIN 2'-5'-oligoadenylate synthase 2 OS=Bos taurus OX=9913 GN=OAS2 PE=2 SV=1
3	P29728	0.0	585	719	0.308	0.466	OAS2_HUMAN 2'-5'-oligoadenylate synthase 2 OS=Homo sapiens OX=9606 GN=OAS2 PE=1 SV=3
4	Q5MYU0	0.0	599	733	0.300	0.445	OAS2_RAT 2'-5'-oligoadenylate synthase 2 OS=Rattus norvegicus OX=10116 GN=Oas2 PE=2 SV=1
5	Q8VI93	0.0	1528	1138	0.705	0.673	OAS3_MOUSE 2'-5'-oligoadenylate synthase 3 OS=Mus musculus OX=10090 GN=Oas3 PE=1 SV=1
6	Q91YM7	0.0	851	515	0.375	0.792	Q91YM7_MOUSE 2'-5' oligoadenylate synthase (Fragment) OS=Mus musculus OX=10090 GN=Oas3 PE=2 SV=1
7	Q9Y6K5	0.0	2244	1087	1.000	1.000	OAS3_HUMAN 2'-5'-oligoadenylate synthase 3 OS=Homo sapiens OX=9606 GN=OAS3 PE=1 SV=3
8	F8VS35	8.90e-145	434	223	0.196	0.955	F8VS35_HUMAN 2'-5'-oligoadenylate synthetase 3 OS=Homo sapiens OX=9606 GN=OAS3 PE=1 SV=1
9	G3SFB1	2.76e-127	396	414	0.191	0.502	G3SFB1_GORGO 2'-5' oligoadenylate synthase OS=Gorilla gorilla gorilla OX=9595 GN=OAS1 PE=3 SV=2
10	H0YIB8	5.22e-127	394	384	0.190	0.536	H0YIB8_HUMAN 2'-5' oligoadenylate synthase OS=Homo sapiens OX=9606 GN=OAS1 PE=1 SV=2
11	P00973	1.38e-126	394	400	0.190	0.515	OAS1_HUMAN 2'-5'-oligoadenylate synthase 1 OS=Homo sapiens OX=9606 GN=OAS1 PE=1 SV=4
12	S4R3A5	1.66e-126	394	403	0.190	0.511	S4R3A5_HUMAN 2'-5' oligoadenylate synthase OS=Homo sapiens OX=9606 GN=OAS1 PE=1 SV=2
13	Q3ZM02	3.06e-125	392	459	0.189	0.447	Q3ZM02_HUMAN 2'-5' oligoadenylate synthase OS=Homo sapiens OX=9606 GN=OAS1 PE=2 SV=1
14	Q29599	2.80e-119	372	349	0.178	0.556	OAS1_PIG 2'-5'-oligoadenylate synthase 1 OS=Sus scrofa OX=9823 GN=OAS1 PE=1 SV=3
15	F8VPW7	2.82e-113	355	306	0.169	0.601	F8VPW7_HUMAN 2'-5'-oligoadenylate synthetase 1 OS=Homo sapiens OX=9606 GN=OAS1 PE=1 SV=2
16	Q05961	3.45e-113	357	358	0.175	0.531	OAS1A_RAT 2'-5'-oligoadenylate synthase 1A OS=Rattus norvegicus OX=10116 GN=Oas1a PE=2 SV=1
17	P11928	6.31e-108	343	367	0.172	0.510	OAS1A_MOUSE 2'-5'-oligoadenylate synthase 1A OS=Mus musculus OX=10090 GN=Oas1a PE=1 SV=2
18	F8VWK9	1.11e-98	311	177	0.142	0.870	F8VWK9_HUMAN 2'-5'-oligoadenylate synthetase 3 OS=Homo sapiens OX=9606 GN=OAS3 PE=1 SV=1
19	Q9Z2F2	1.39e-88	296	508	0.145	0.311	OASL2_MOUSE 2'-5'-oligoadenylate synthase-like protein 2 OS=Mus musculus OX=10090 GN=Oasl2 PE=1 SV=2
20	Q60856	1.16e-87	289	376	0.153	0.441	OAS1B_MOUSE Inactive 2'-5'-oligoadenylate synthase 1B OS=Mus musculus OX=10090 GN=Oas1b PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01909 NTP_transf_2	1.9e-14	65.0	Nucleotidyltransferase domain
2	PF10421 OAS1_C	1.3e-240	802.8	2'-5'-oligoadenylate synthetase 1, domain 2, C-terminus
3	PF18144 SMODS	5.5e-11	54.4	Second Messenger Oligonucleotide or Dinucleotide Synthetase domain
4	PF07404 TEBP_beta	2.5e+02	12.8	Telomere-binding protein beta subunit (TEBP beta)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000228928

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360883	0.995	Interferon-induced protein with tetratricopeptide repeats 3
2	9606.ENSP00000360869	0.994	Interferon-induced protein with tetratricopeptide repeats 1
3	9606.ENSP00000368699	0.994	Ubiquitin-like protein ISG15
4	9606.ENSP00000371471	0.994	Radical S-adenosyl methionine domain-containing protein 2
5	9606.ENSP00000381601	0.993	Interferon-induced GTP-binding protein Mx1
6	9606.ENSP00000342513	0.991	Plays a role in apoptosis, negatively regulating the intrinsinc apoptotic signaling pathway and TNFSF10-induced apoptosis . However, it has also been shown to have a pro-apoptotic activity . Has an antiviral activity towards hepatitis C virus/HCV by inhibiting the EGFR signaling pathway, which activation is required for entry of the virus into cells . ECO:0000269\|PubMed:17823654, ECO:0000269\|PubMed:25757571,
7	9606.ENSP00000360891	0.989	Interferon-induced protein with tetratricopeptide repeats 2
8	9606.ENSP00000333657	0.988	Interferon-induced GTP-binding protein Mx2
9	9606.ENSP00000354394	0.988	Signal transducer and activator of transcription 1-alpha/beta
10	9606.ENSP00000395590	0.988	Interferon-induced 35 kDa protein
11	9606.ENSP00000354822	0.985	XIAP-associated factor 1
12	9606.ENSP00000380697	0.985	Interferon regulatory factor 7
13	9606.ENSP00000360860	0.983	Interferon-induced protein with tetratricopeptide repeats 5
14	9606.ENSP00000356530	0.978	2-5A-dependent ribonuclease
15	9606.ENSP00000357459	0.972	Double-stranded RNA-specific adenosine deaminase
16	9606.ENSP00000380073	0.967	Interferon regulatory factor 9
17	9606.ENSP00000306565	0.965	Interferon-stimulated gene 20 kDa protein
18	9606.ENSP00000386187	0.965	Interferon-induced transmembrane protein 1
19	9606.ENSP00000388001	0.963	2'-5'-oligoadenylate synthase 1
20	9606.ENSP00000483430	0.961	Interferon alpha-inducible protein 27, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003725	1.000	double-stranded RNA binding
GO:0005524	1.000	ATP binding
GO:0005515	0.998	protein binding
GO:0001730	0.998	2'-5'-oligoadenylate synthetase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0050896	0.986	response to stimulus
GO:0009987	0.983	cellular process
GO:0048518	0.982	positive regulation of biological process
GO:0048525	0.977	negative regulation of viral process
GO:0002376	0.976	immune system process
GO:0045069	0.976	regulation of viral genome replication
GO:0009615	0.967	response to virus
GO:0009966	0.961	regulation of signal transduction
GO:0044238	0.951	primary metabolic process
GO:0045089	0.951	positive regulation of innate immune response
GO:0045071	0.950	negative regulation of viral genome replication
GO:0051716	0.939	cellular response to stimulus
GO:0006952	0.935	defense response
GO:0060255	0.935	regulation of macromolecule metabolic process
GO:0051607	0.933	defense response to virus
GO:0051252	0.927	regulation of RNA metabolic process
GO:0001819	0.925	positive regulation of cytokine production
GO:0060759	0.924	regulation of response to cytokine stimulus
GO:0071704	0.910	organic substance metabolic process
GO:0060338	0.906	regulation of type I interferon-mediated signaling pathway
GO:0048523	0.905	negative regulation of cellular process
GO:0050777	0.905	negative regulation of immune response
GO:0045824	0.903	negative regulation of innate immune response
GO:0032648	0.899	regulation of interferon-beta production
GO:0007154	0.885	cell communication
GO:0007165	0.879	signal transduction
GO:0032481	0.854	positive regulation of type I interferon production
GO:0002253	0.853	activation of immune response
GO:1903555	0.843	regulation of tumor necrosis factor superfamily cytokine production
GO:0006807	0.834	nitrogen compound metabolic process
GO:0002764	0.829	immune response-regulating signaling pathway
GO:0002218	0.827	activation of innate immune response
GO:0002757	0.823	immune response-activating signaling pathway
GO:0065009	0.821	regulation of molecular function
GO:0030522	0.821	intracellular receptor signaling pathway
GO:0009968	0.819	negative regulation of signal transduction
GO:0044237	0.816	cellular metabolic process
GO:0060761	0.809	negative regulation of response to cytokine stimulus
GO:0002753	0.808	cytosolic pattern recognition receptor signaling pathway
GO:0050790	0.806	regulation of catalytic activity
GO:0032680	0.795	regulation of tumor necrosis factor production
GO:0032069	0.759	regulation of nuclease activity
GO:0032722	0.726	positive regulation of chemokine production
GO:0010605	0.573	negative regulation of macromolecule metabolic process
GO:0006725	0.553	cellular aromatic compound metabolic process
GO:0048522	0.547	positive regulation of cellular process
GO:0034641	0.539	cellular nitrogen compound metabolic process
GO:0034097	0.465	response to cytokine
GO:0032728	0.456	positive regulation of interferon-beta production
GO:0045087	0.364	innate immune response
GO:0006139	0.361	nucleobase-containing compound metabolic process
GO:0010629	0.347	negative regulation of gene expression
GO:0032760	0.341	positive regulation of tumor necrosis factor production

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0016020	0.999	membrane
GO:0005654	0.999	nucleoplasm
GO:0071944	0.991	cell periphery
GO:0005886	0.981	plasma membrane
GO:0005576	0.977	extracellular region
GO:0005615	0.720	extracellular space
GO:0043228	0.686	non-membrane-bounded organelle
GO:0043232	0.666	intracellular non-membrane-bounded organelle
GO:0031982	0.308	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34407	0.998	3 ATP = 5'-triphosphoadenylyl-(2'->5')-adenylyl-(2'->5')-adenosine + 2 diphosphate
EC:2.7.7.84	0.998	2'-5' oligoadenylate synthase.

[back to server]