StarFunc result for job id Q9Y6K8

User Input

>input (562 residues)
MNTNDAKEYLARREIPQLFESLLNGLMCSKPEDPVEYLESCLQKVKELGGCDKVKWDTFV
SQEKKTLPPLNGGQSRRSFLRNVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIE
EYEVFDPTRPRPKIILVIGGPGSGKGTQSLKIAERYGFQYISVGELLRKKIHSTSSNRKW
SLIAKIITTGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICTPDLV
VFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDA
DRDEDEVFYDISMAVDNKLFPNKEAAAGSSDLDPSMILDTGEIIDTGSDYEDQGDDQLNV
FGEDTMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASESE
RSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDP
QLVICMDCSADTMTNRLLQRSRSSLPVDDTTKTIAKRLEAYYRASIPVIAYYETKTQLHK
INAEGTPEDVFLQLCTAIDSIF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y6K8	1.000	1.000	6.149E-94	562	1.000	1.000	Q9Y6K8.pdb.gz	KAD5_HUMAN Adenylate kinase isoenzyme 5 OS=Homo sapiens OX=9606 GN=AK5 PE=1 SV=2
2	AFDB:A5PMF1	0.427	0.426	5.597E-67	563	0.637	0.636	A5PMF1.pdb.gz	A5PMF1_DANRE Adenylate kinase 5 OS=Danio rerio OX=7955 GN=wu:fj63a06 PE=1 SV=1
3	AFDB:Q32M07	0.292	0.340	2.319E-22	479	0.167	0.196	Q32M07.pdb.gz	KAD8_MOUSE Adenylate kinase 8 OS=Mus musculus OX=10090 GN=Ak8 PE=1 SV=1
4	AFDB:Q96MA6	0.292	0.340	5.442E-21	479	0.167	0.196	Q96MA6.pdb.gz	KAD8_HUMAN Adenylate kinase 8 OS=Homo sapiens OX=9606 GN=AK8 PE=1 SV=1
5	PDB:2c95A	0.318	0.871	6.702E-21	195	0.198	0.569	2c95A.pdb.gz	Structure of Adenylate Kinase 1 in Complex with P1, P4-Di(Adenosine)Tetraphosphate
6	AFDB:Q5T9B7	0.332	0.846	7.816E-21	210	0.199	0.533	Q5T9B7.pdb.gz	Q5T9B7_HUMAN Adenylate kinase isoenzyme 1 OS=Homo sapiens OX=9606 GN=AK1 PE=1 SV=1
7	AFDB:A0A4X1T4U3	0.292	0.328	9.613E-21	498	0.174	0.197	A0A4X1T4U3.pdb.gz	KAD8_PIG Adenylate kinase 8 OS=Sus scrofa OX=9823 GN=AK8 PE=1 SV=2
8	AFDB:P39069	0.316	0.869	5.877E-20	194	0.192	0.557	P39069.pdb.gz	KAD1_RAT Adenylate kinase isoenzyme 1 OS=Rattus norvegicus OX=10116 GN=Ak1 PE=1 SV=3
9	AFDB:P05081	0.312	0.861	2.922E-19	194	0.189	0.546	P05081.pdb.gz	KAD1_CHICK Adenylate kinase isoenzyme 1 OS=Gallus gallus OX=9031 GN=AK1 PE=1 SV=1
10	AFDB:Q8IQG9	0.314	0.736	2.699E-16	229	0.153	0.376	Q8IQG9.pdb.gz	Q8IQG9_DROME Adenylate kinase 1, isoform B OS=Drosophila melanogaster OX=7227 GN=Ak1 PE=1 SV=1
11	AFDB:Q6NMK6	0.320	0.668	3.876E-16	259	0.146	0.317	Q6NMK6.pdb.gz	KCY2_ARATH Probable UMP-CMP kinase 2 OS=Arabidopsis thaliana OX=3702 GN=UMK2 PE=2 SV=2
12	PDB:1ukyA	0.325	0.908	1.275E-15	196	0.114	0.327	1ukyA.pdb.gz	Substrate specificity and assembly of the catalytic center derived from two structures of ligated uridylate kinase.
13	PDB:1tevA	0.301	0.820	2.311E-14	194	0.121	0.351	1tevA.pdb.gz
14	PDB:1qf9A	0.320	0.896	4.299E-14	194	0.103	0.299	1qf9A.pdb.gz	pH influences fluoride coordination number of the AlFx phosphoryl transfer transition state analog.
15	PDB:2cdnA	0.298	0.859	5.281E-12	186	0.110	0.333	2cdnA.pdb.gz	The Crystal Structure of Mycobacterium Tuberculosis Adenylate Kinase in Complex with Two Molecules of Adp and Mg2+ Supports an Associative Mechanism for Phosphoryl Transfer.
16	PDB:2c9yA	0.286	0.688	7.387E-11	218	0.107	0.275	2c9yA.pdb.gz	Structure of Human Adenylate Kinase 2
17	PDB:1akeA	0.275	0.679	9.567E-11	214	0.103	0.271	1akeA.pdb.gz	Structure of the complex between adenylate kinase from Escherichia coli and the inhibitor Ap5A refined at 1.9 A resolution. A model for a catalytic transition state.
18	PDB:1dvrA	0.288	0.691	1.974E-10	220	0.080	0.205	1dvrA.pdb.gz	Structure of a mutant adenylate kinase ligated with an ATP-analogue showing domain closure over ATP.
19	PDB:3tlxB	0.300	0.681	1.974E-10	240	0.101	0.237	3tlxB.pdb.gz	Crystal Structure of PF10_0086, adenylate kinase from plasmodium falciparum
20	PDB:2ar7A	0.268	0.613	4.288E-10	221	0.096	0.244	2ar7A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A5PMF1	0.0	759	563	0.646	0.645	A5PMF1_DANRE Adenylate kinase 5 OS=Danio rerio OX=7955 GN=wu:fj63a06 PE=1 SV=1
2	Q9Y6K8	0.0	1154	562	1.000	1.000	KAD5_HUMAN Adenylate kinase isoenzyme 5 OS=Homo sapiens OX=9606 GN=AK5 PE=1 SV=2
3	P00571	2.17e-77	244	194	0.201	0.582	KAD1_PIG Adenylate kinase isoenzyme 1 OS=Sus scrofa OX=9823 GN=AK1 PE=1 SV=1
4	P00568	3.02e-76	241	194	0.199	0.577	KAD1_HUMAN Adenylate kinase isoenzyme 1 OS=Homo sapiens OX=9606 GN=AK1 PE=1 SV=3
5	Q6FGX9	3.02e-76	241	194	0.199	0.577	Q6FGX9_HUMAN Adenylate kinase isoenzyme 1 OS=Homo sapiens OX=9606 GN=AK1 PE=2 SV=1
6	Q5T9B7	2.48e-75	239	210	0.199	0.533	Q5T9B7_HUMAN Adenylate kinase isoenzyme 1 OS=Homo sapiens OX=9606 GN=AK1 PE=1 SV=1
7	Q9R0Y5	5.66e-75	238	194	0.198	0.572	KAD1_MOUSE Adenylate kinase isoenzyme 1 OS=Mus musculus OX=10090 GN=Ak1 PE=1 SV=1
8	P39069	2.27e-74	236	194	0.198	0.572	KAD1_RAT Adenylate kinase isoenzyme 1 OS=Rattus norvegicus OX=10116 GN=Ak1 PE=1 SV=3
9	P05081	5.56e-71	228	194	0.189	0.546	KAD1_CHICK Adenylate kinase isoenzyme 1 OS=Gallus gallus OX=9031 GN=AK1 PE=1 SV=1
10	Q9VTV3	2.44e-48	168	201	0.155	0.433	Q9VTV3_DROME AT17975p OS=Drosophila melanogaster OX=7227 GN=Ak1 PE=1 SV=1
11	Q8IQG9	6.82e-48	168	229	0.155	0.380	Q8IQG9_DROME Adenylate kinase 1, isoform B OS=Drosophila melanogaster OX=7227 GN=Ak1 PE=1 SV=1
12	P15700	3.01e-42	152	204	0.133	0.368	KCY_YEAST Uridylate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=URA6 PE=1 SV=1
13	Q6NMK6	4.71e-42	154	259	0.137	0.297	KCY2_ARATH Probable UMP-CMP kinase 2 OS=Arabidopsis thaliana OX=3702 GN=UMK2 PE=2 SV=2
14	O04905	6.22e-41	149	202	0.137	0.381	KCY3_ARATH UMP-CMP kinase 3 OS=Arabidopsis thaliana OX=3702 GN=UMK3 PE=1 SV=1
15	Q8VY84	1.52e-38	142	204	0.130	0.358	KCY1_ARATH Probable UMP-CMP kinase 1 OS=Arabidopsis thaliana OX=3702 GN=UMK1 PE=2 SV=1
16	Q9VBI2	1.75e-36	138	253	0.137	0.304	Q9VBI2_DROME UMP-CMP kinase OS=Drosophila melanogaster OX=7227 GN=Cmpk PE=1 SV=1
17	Q8IGD0	6.17e-36	138	304	0.137	0.253	Q8IGD0_DROME RH52725p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Cmpk PE=2 SV=1
18	P30085	1.09e-35	134	196	0.123	0.352	KCY_HUMAN UMP-CMP kinase OS=Homo sapiens OX=9606 GN=CMPK1 PE=1 SV=3
19	Q4KM73	2.27e-35	133	196	0.121	0.347	KCY_RAT UMP-CMP kinase OS=Rattus norvegicus OX=10116 GN=Cmpk1 PE=1 SV=2
20	Q38EC4	8.27e-35	132	200	0.110	0.310	Q38EC4_TRYB2 Adenylate kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.0350 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	5.2	18.9	ATPase family associated with various cellular activities (AAA)
2	PF13191 AAA_16	25	16.7	AAA ATPase domain
3	PF13207 AAA_17	6.5e-53	190.2	AAA domain
4	PF13238 AAA_18	7.4e-15	67.1	AAA domain
5	PF13245 AAA_19	0.35	22.6	AAA domain
6	PF13401 AAA_22	0.21	23.3	AAA domain
7	PF13521 AAA_28	0.054	25.2	AAA domain
8	PF13555 AAA_29	2.9e+02	12.6	P-loop containing region of AAA domain
9	PF13671 AAA_33	8.1e-08	44.0	AAA domain
10	PF00406 ADK	5.8e-78	271.7	Adenylate kinase
11	PF06745 ATPase	3e+02	12.1	KaiC
12	PF02283 CobU	66	14.5	Cobinamide kinase / cobinamide phosphate guanyltransferase
13	PF02224 Cytidylate_kin	0.0044	28.3	Cytidylate kinase
14	PF13189 Cytidylate_kin2	39	15.9	Cytidylate kinase-like family
15	PF01712 dNK	0.27	22.6	Deoxynucleoside kinase
16	PF05186 Dpy-30	3.5e+02	12.3	Dpy-30 motif
17	PF09848 DUF2075	4.8e+02	11.3	Schlafen group 3, DNA/RNA helicase domain
18	PF17213 Hydin_ADK	2.7	19.6	Hydin Adenylate kinase-like domain
19	PF03266 NTPase_1	1e+02	14.2	NTPase
20	PF18751 Ploopntkinase3	53	14.8	P-loop Nucleotide Kinase3

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000346577

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356785	0.947	Nucleoside diphosphate kinase 7
2	9606.ENSP00000265191	0.946	Nucleoside diphosphate kinase homolog 5
3	9606.ENSP00000219302	0.944	Nucleoside diphosphate kinase 3
4	9606.ENSP00000367615	0.944	Adenine phosphoribosyltransferase
5	9606.ENSP00000416658	0.938	Nucleoside diphosphate kinase 6
6	9606.ENSP00000286621	0.934	Adenosine kinase
7	9606.ENSP00000264093	0.927	Deoxyguanosine kinase, mitochondrial
8	9606.ENSP00000219479	0.925	Nucleoside diphosphate kinase, mitochondrial
9	9606.ENSP00000300738	0.917	Ribonucleoside-diphosphate reductase large subunit
10	9606.ENSP00000337060	0.917	Nucleoside diphosphate kinase A
11	9606.ENSP00000347213	0.916	Ectonucleoside triphosphate diphosphohydrolase 2
12	9606.ENSP00000485525	0.916	Adenylosuccinate lyase
13	9606.ENSP00000286648	0.906	Deoxycytidine kinase
14	9606.ENSP00000353165	0.905	Thiamin pyrophosphokinase 1
15	9606.ENSP00000251810	0.904	Ribonucleoside-diphosphate reductase subunit M2 B
16	9606.ENSP00000353770	0.904	Ribonucleoside-diphosphate reductase subunit M2
17	9606.ENSP00000355587	0.900	Cancer-related nucleoside-triphosphatase
18	9606.ENSP00000267584	0.891	Adenylate kinase 7
19	9606.ENSP00000440077	0.867	Copine-6
20	9606.ENSP00000410186	0.808	Adenylate kinase 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004550	0.999	nucleoside diphosphate kinase activity
GO:0004017	0.999	adenylate kinase activity
GO:0005488	0.931	binding
GO:0043167	0.720	ion binding
GO:0097159	0.670	organic cyclic compound binding
GO:1901363	0.661	heterocyclic compound binding
GO:0043168	0.617	anion binding
GO:0017076	0.529	purine nucleotide binding
GO:0005515	0.450	protein binding
GO:0097367	0.359	carbohydrate derivative binding
GO:0032555	0.354	purine ribonucleotide binding
GO:0032559	0.311	adenyl ribonucleotide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.988	organic substance metabolic process
GO:0044237	0.988	cellular metabolic process
GO:0044238	0.987	primary metabolic process
GO:1901135	0.980	carbohydrate derivative metabolic process
GO:1901564	0.979	organonitrogen compound metabolic process
GO:0034641	0.978	cellular nitrogen compound metabolic process
GO:0006725	0.973	cellular aromatic compound metabolic process
GO:1901566	0.960	organonitrogen compound biosynthetic process
GO:0009259	0.957	ribonucleotide metabolic process
GO:0009165	0.953	nucleotide biosynthetic process
GO:0019692	0.951	deoxyribose phosphate metabolic process
GO:0009262	0.951	deoxyribonucleotide metabolic process
GO:0072527	0.947	pyrimidine-containing compound metabolic process
GO:1901137	0.939	carbohydrate derivative biosynthetic process
GO:0006163	0.936	purine nucleotide metabolic process
GO:0009260	0.933	ribonucleotide biosynthetic process
GO:0009394	0.909	2'-deoxyribonucleotide metabolic process
GO:0009150	0.891	purine ribonucleotide metabolic process
GO:0006220	0.888	pyrimidine nucleotide metabolic process
GO:0009185	0.878	ribonucleoside diphosphate metabolic process
GO:0046385	0.867	deoxyribose phosphate biosynthetic process
GO:0072528	0.848	pyrimidine-containing compound biosynthetic process
GO:0009265	0.839	2'-deoxyribonucleotide biosynthetic process
GO:0046939	0.817	nucleotide phosphorylation
GO:0006165	0.808	nucleoside diphosphate phosphorylation
GO:0009141	0.800	nucleoside triphosphate metabolic process
GO:0006221	0.785	pyrimidine nucleotide biosynthetic process
GO:0009142	0.781	nucleoside triphosphate biosynthetic process
GO:0006164	0.779	purine nucleotide biosynthetic process
GO:0009135	0.701	purine nucleoside diphosphate metabolic process
GO:0009218	0.693	pyrimidine ribonucleotide metabolic process
GO:0009179	0.665	purine ribonucleoside diphosphate metabolic process
GO:0046031	0.537	ADP metabolic process
GO:0009152	0.416	purine ribonucleotide biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.999	intracellular organelle
GO:0005829	0.999	cytosol
GO:0043232	0.971	intracellular non-membrane-bounded organelle
GO:0005856	0.936	cytoskeleton
GO:0005815	0.911	microtubule organizing center
GO:0005813	0.900	centrosome
GO:0034451	0.889	centriolar satellite
GO:0043227	0.744	membrane-bounded organelle
GO:0043231	0.581	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.4.6	0.999	nucleoside-diphosphate kinase.
RHEA:12973	0.999	AMP + ATP = 2 ADP
EC:2.7.4.3	0.999	adenylate kinase.

[back to server]