StarFunc result for job id Q9Y6K9

User Input

>input (419 residues)
MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQE
LRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQ
ALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQ
ARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQE
YDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV
LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRH
VEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y6K9	1.000	1.000	3.937E-53	419	1.000	1.000	Q9Y6K9.pdb.gz	NEMO_HUMAN NF-kappa-B essential modulator OS=Homo sapiens OX=9606 GN=IKBKG PE=1 SV=2
2	AFDB:O88522	0.468	0.475	1.316E-41	412	0.866	0.881	O88522.pdb.gz	NEMO_MOUSE NF-kappa-B essential modulator OS=Mus musculus OX=10090 GN=Ikbkg PE=1 SV=2
3	AFDB:Q5RI56	0.265	0.224	4.409E-8	517	0.272	0.221	Q5RI56.pdb.gz	OPTN_DANRE Optineurin OS=Danio rerio OX=7955 GN=optn PE=2 SV=2
4	AFDB:Q9GYV5	0.159	0.170	2.203E-3	387	0.181	0.196	Q9GYV5.pdb.gz	NEMO_DROME NF-kappa-B essential modulator OS=Drosophila melanogaster OX=7227 GN=key PE=1 SV=1
5	AFDB:P93203	0.384	0.255	4.254E-1	697	0.189	0.113	P93203.pdb.gz	MFP1_SOLLC MAR-binding filament-like protein 1 OS=Solanum lycopersicum OX=4081 GN=MFP1 PE=1 SV=1
6	AFDB:Q5XHZ2	0.243	0.288	8.213E-1	329	0.193	0.246	Q5XHZ2.pdb.gz	SYCE1_RAT Synaptonemal complex central element protein 1 OS=Rattus norvegicus OX=10116 GN=Syce1 PE=2 SV=2
7	AFDB:Q8BT07	0.192	0.178	1.023	462	0.196	0.177	Q8BT07.pdb.gz	CEP55_MOUSE Centrosomal protein of 55 kDa OS=Mus musculus OX=10090 GN=Cep55 PE=1 SV=2
8	AFDB:Q9LTY1	0.331	0.207	1.023	726	0.150	0.087	Q9LTY1.pdb.gz	MAD1_ARATH Mitotic spindle checkpoint protein MAD1 OS=Arabidopsis thaliana OX=3702 GN=MAD1 PE=1 SV=1
9	AFDB:A0A0B4KHS3	0.265	0.160	1.184	805	0.181	0.094	A0A0B4KHS3.pdb.gz	A0A0B4KHS3_DROME Miranda, isoform C OS=Drosophila melanogaster OX=7227 GN=mira PE=4 SV=1
10	AFDB:Q8IXS2	0.261	0.233	1.370	484	0.141	0.122	Q8IXS2.pdb.gz	DRC2_HUMAN Dynein regulatory complex subunit 2 OS=Homo sapiens OX=9606 GN=CCDC65 PE=1 SV=2
11	PDB:6vlzQ	0.047	0.064	9.940	240	0.024	0.042	6vlzQ.pdb.gz	Structures of the human mitochondrial ribosome bound to EF-G1 reveal distinct features of mitochondrial translation elongation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WUW6	0.0	808	412	0.983	1.000	A0A087WUW6_HUMAN Inhibitor of nuclear factor kappa B kinase regulatory subunit gamma OS=Homo sapiens OX=9606 GN=IKBKG PE=1 SV=1
2	A0A087X0G7	0.0	801	411	0.981	1.000	A0A087X0G7_HUMAN Inhibitor of nuclear factor kappa B kinase regulatory subunit gamma OS=Homo sapiens OX=9606 GN=IKBKG PE=1 SV=1
3	A0A087X1B1	0.0	823	418	0.998	1.000	A0A087X1B1_HUMAN Inhibitor of nuclear factor kappa B kinase regulatory subunit gamma OS=Homo sapiens OX=9606 GN=IKBKG PE=1 SV=1
4	C9J2V2	0.0	800	407	0.971	1.000	C9J2V2_HUMAN Inhibitor of nuclear factor kappa B kinase regulatory subunit gamma OS=Homo sapiens OX=9606 GN=IKBKG PE=1 SV=2
5	O88522	0.0	697	412	0.866	0.881	NEMO_MOUSE NF-kappa-B essential modulator OS=Mus musculus OX=10090 GN=Ikbkg PE=1 SV=2
6	Q6TMG5	0.0	693	412	0.874	0.888	NEMO_RAT NF-kappa-B essential modulator OS=Rattus norvegicus OX=10116 GN=Ikbkg PE=2 SV=1
7	Q9Y6K9	0.0	829	419	1.000	1.000	NEMO_HUMAN NF-kappa-B essential modulator OS=Homo sapiens OX=9606 GN=IKBKG PE=1 SV=2
8	C9JN51	2.44e-176	493	250	0.597	1.000	C9JN51_HUMAN NF-kappa-B essential modulator (Fragment) OS=Homo sapiens OX=9606 GN=IKBKG PE=1 SV=8
9	C9JH59	1.57e-118	344	172	0.411	1.000	C9JH59_HUMAN NF-kappa-B essential modulator (Fragment) OS=Homo sapiens OX=9606 GN=IKBKG PE=1 SV=8
10	C9JCG6	3.86e-94	281	138	0.329	1.000	C9JCG6_HUMAN NF-kappa-B essential modulator (Fragment) OS=Homo sapiens OX=9606 GN=IKBKG PE=1 SV=1
11	F1QHG7	5.15e-68	228	602	0.363	0.252	F1QHG7_DANRE Inhibitor of nuclear factor kappa B kinase regulatory subunit gamma (Fragment) OS=Danio rerio OX=7955 GN=fj33c07 PE=1 SV=1
12	Q58EN3	7.11e-68	228	586	0.363	0.259	Q58EN3_DANRE Ikbkg protein OS=Danio rerio OX=7955 GN=wu:fj33c07 PE=1 SV=1
13	Q5RI56	3.45e-35	138	517	0.232	0.188	OPTN_DANRE Optineurin OS=Danio rerio OX=7955 GN=optn PE=2 SV=2
14	Q8K3K8	7.02e-29	120	584	0.227	0.163	OPTN_MOUSE Optineurin OS=Mus musculus OX=10090 GN=Optn PE=1 SV=1
15	Q8R5M4	9.12e-29	120	585	0.227	0.162	OPTN_RAT Optineurin OS=Rattus norvegicus OX=10116 GN=Optn PE=1 SV=3
16	Q96CV9	2.04e-27	116	577	0.229	0.166	OPTN_HUMAN Optineurin OS=Homo sapiens OX=9606 GN=OPTN PE=1 SV=3
17	Q6S003	3.78e-04	45.4	1873	0.091	0.020	KIF8_DICDI Kinesin-related protein 8 OS=Dictyostelium discoideum OX=44689 GN=kif8 PE=2 SV=1
18	Q8IDX6	8.30e-04	44.3	3130	0.110	0.015	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
19	Q9GYV5	8.49e-04	43.5	387	0.169	0.183	NEMO_DROME NF-kappa-B essential modulator OS=Drosophila melanogaster OX=7227 GN=key PE=1 SV=1
20	Q96KP6	0.001	43.1	325	0.095	0.123	TNIP3_HUMAN TNFAIP3-interacting protein 3 OS=Homo sapiens OX=9606 GN=TNIP3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05791 Bacillus_HBL	85	14.4	Bacillus haemolytic enterotoxin (HBL)
2	PF16516 CC2-LZ	9e-25	98.3	Leucine zipper of domain CC2 of NEMO, NF-kappa-B essential modulator
3	PF14945 LLC1	1.3e+02	14.5	Normal lung function maintenance, Low in Lung Cancer 1 protein
4	PF11577 NEMO	1.9e-23	93.6	NF-kappa-B essential modulator NEMO
5	PF18414 zf_C2H2_10	5e-13	59.6	C2H2 type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000483825

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216797	0.999	NF-kappa-B inhibitor alpha
2	9606.ENSP00000259808	0.999	Receptor-interacting serine/threonine-protein kinase 1
3	9606.ENSP00000262971	0.999	E3 SUMO-protein ligase PIAS4
4	9606.ENSP00000278616	0.999	Serine-protein kinase ATM
5	9606.ENSP00000329967	0.999	Serine/threonine-protein kinase TBK1
6	9606.ENSP00000358997	0.999	Interleukin-1 receptor-associated kinase 1
7	9606.ENSP00000359424	0.999	Inhibitor of nuclear factor kappa-B kinase subunit alpha
8	9606.ENSP00000359612	0.999	B-cell lymphoma/leukemia 10
9	9606.ENSP00000376505	0.999	TRAF family member-associated NF-kappa-B activator
10	9606.ENSP00000392025	0.999	Ubiquitin carboxyl-terminal hydrolase CYLD
11	9606.ENSP00000430684	0.999	Inhibitor of nuclear factor kappa-B kinase subunit beta
12	9606.ENSP00000433623	0.999	TNF receptor-associated factor 6
13	9606.ENSP00000162749	0.998	Tumor necrosis factor receptor superfamily member 1A
14	9606.ENSP00000356426	0.998	TGF-beta-activated kinase 1 and MAP3K7-binding protein 2
15	9606.ENSP00000398698	0.998	Tumor necrosis factor
16	9606.ENSP00000468263	0.998	ELKS/Rab6-interacting/CAST family member 1
17	9606.ENSP00000220751	0.997	Receptor-interacting serine/threonine-protein kinase 2
18	9606.ENSP00000315112	0.997	E3 ubiquitin-protein ligase RNF31
19	9606.ENSP00000316176	0.997	Ubiquitin-conjugating enzyme E2 N
20	9606.ENSP00000380150	0.997	Caspase recruitment domain-containing protein 11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0005102	0.999	signaling receptor binding
GO:0070530	0.999	K63-linked polyubiquitin modification-dependent protein binding
GO:0019899	0.994	enzyme binding
GO:0043130	0.976	ubiquitin binding
GO:0019904	0.961	protein domain specific binding
GO:0042803	0.946	protein homodimerization activity
GO:0044389	0.869	ubiquitin-like protein ligase binding
GO:0031625	0.863	ubiquitin protein ligase binding
GO:0046982	0.835	protein heterodimerization activity
GO:1990450	0.578	linear polyubiquitin binding
GO:1990459	0.575	transferrin receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0050896	0.995	response to stimulus
GO:0009987	0.995	cellular process
GO:0048522	0.992	positive regulation of cellular process
GO:0007165	0.989	signal transduction
GO:0010941	0.984	regulation of cell death
GO:0065009	0.983	regulation of molecular function
GO:1902531	0.976	regulation of intracellular signal transduction
GO:0044093	0.971	positive regulation of molecular function
GO:0035556	0.969	intracellular signal transduction
GO:0048519	0.961	negative regulation of biological process
GO:0051173	0.960	positive regulation of nitrogen compound metabolic process
GO:0048523	0.954	negative regulation of cellular process
GO:0060255	0.946	regulation of macromolecule metabolic process
GO:0010468	0.932	regulation of gene expression
GO:0080090	0.928	regulation of primary metabolic process
GO:0031323	0.919	regulation of cellular metabolic process
GO:0048584	0.906	positive regulation of response to stimulus
GO:0010604	0.901	positive regulation of macromolecule metabolic process
GO:1902533	0.897	positive regulation of intracellular signal transduction
GO:0043122	0.886	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0031325	0.882	positive regulation of cellular metabolic process
GO:0002376	0.880	immune system process
GO:0008219	0.816	cell death
GO:0002682	0.812	regulation of immune system process
GO:0006950	0.806	response to stress
GO:0007249	0.741	I-kappaB kinase/NF-kappaB signaling
GO:0010556	0.704	regulation of macromolecule biosynthetic process
GO:0031326	0.704	regulation of cellular biosynthetic process
GO:0019219	0.704	regulation of nucleobase-containing compound metabolic process
GO:0009605	0.683	response to external stimulus
GO:0051252	0.677	regulation of RNA metabolic process
GO:0006355	0.673	regulation of DNA-templated transcription
GO:0043123	0.628	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0051707	0.613	response to other organism
GO:0051090	0.597	regulation of DNA-binding transcription factor activity
GO:0060548	0.593	negative regulation of cell death
GO:0071840	0.563	cellular component organization or biogenesis
GO:0071704	0.544	organic substance metabolic process
GO:0016043	0.543	cellular component organization
GO:0050776	0.537	regulation of immune response
GO:0044238	0.530	primary metabolic process
GO:0051246	0.523	regulation of protein metabolic process
GO:0002684	0.520	positive regulation of immune system process
GO:0012501	0.509	programmed cell death
GO:0080134	0.488	regulation of response to stress
GO:0006807	0.484	nitrogen compound metabolic process
GO:0042981	0.477	regulation of apoptotic process
GO:0043170	0.461	macromolecule metabolic process
GO:0050790	0.454	regulation of catalytic activity
GO:1901564	0.424	organonitrogen compound metabolic process
GO:2001233	0.424	regulation of apoptotic signaling pathway
GO:0006915	0.402	apoptotic process
GO:0044237	0.383	cellular metabolic process
GO:0042221	0.378	response to chemical
GO:0043066	0.377	negative regulation of apoptotic process
GO:0019538	0.376	protein metabolic process
GO:0051239	0.375	regulation of multicellular organismal process
GO:0006952	0.365	defense response
GO:0009968	0.353	negative regulation of signal transduction
GO:0051179	0.344	localization
GO:1905897	0.344	regulation of response to endoplasmic reticulum stress
GO:0051091	0.342	positive regulation of DNA-binding transcription factor activity
GO:0051247	0.325	positive regulation of protein metabolic process
GO:0031399	0.311	regulation of protein modification process
GO:1903573	0.305	negative regulation of response to endoplasmic reticulum stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.995	cytosol
GO:0005856	0.397	cytoskeleton
GO:1990234	0.392	transferase complex
GO:0015630	0.390	microtubule cytoskeleton
GO:0140535	0.385	intracellular protein-containing complex
GO:0008385	0.381	IkappaB kinase complex
GO:0000151	0.372	ubiquitin ligase complex
GO:0000922	0.372	spindle pole
GO:0072686	0.370	mitotic spindle
GO:0043231	0.302	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]