StarFunc result for job id Q9Y6L7

User Input

>input (1015 residues)
MPRATALGALVSLLLLLPLPRGAGGLGERPDATADYSELDGEEGTEQQLEHYHDPCKAAV
FWGDIALDEDDLKLFHIDKARDWTKQTVGATGHSTGGLEEQASESSPDTTAMDTGTKEAG
KDGRENTTLLHSPGTLHAAAKTFSPRVRRATTSRTERIWPGGVIPYVIGGNFTGSQRAIF
KQAMRHWEKHTCVTFIERTDEESFIVFSYRTCGCCSYVGRRGGGPQAISIGKNCDKFGIV
AHELGHVVGFWHEHTRPDRDQHVTIIRENIQPGQEYNFLKMEAGEVSSLGETYDFDSIMH
YARNTFSRGVFLDTILPRQDDNGVRPTIGQRVRLSQGDIAQARKLYKCPACGETLQDTTG
NFSAPGFPNGYPSYSHCVWRISVTPGEKIVLNFTSMDLFKSRLCWYDYVEVRDGYWRKAP
LLGRFCGDKIPEPLVSTDSRLWVEFRSSSNILGKGFFAAYEATCGGDMNKDAGQIQSPNY
PDDYRPSKECVWRITVSEGFHVGLTFQAFEIERHDSCAYDYLEVRDGPTEESALIGHFCG
YEKPEDVKSSSNRLWMKFVSDGSINKAGFAANFFKEVDECSWPDHGGCEHRCVNTLGSYK
CACDPGYELAADKKMCEVACGGFITKLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISL
QFEVFELEGNDVCKYDFVEVRSGLSPDAKLHGRFCGSETPEVITSQSNNMRVEFKSDNTV
SKRGFRAHFFSDKDECAKDNGGCQHECVNTFGSYLCRCRNGYWLHENGHDCKEAGCAHKI
SSVEGTLASPNWPDKYPSRRECTWNISSTAGHRVKLTFNEFEIEQHQECAYDHLEMYDGP
DSLAPILGRFCGSKKPDPTVASGSSMFLRFYSDASVQRKGFQAVHSTECGGRLKAEVQTK
ELYSHAQFGDNNYPSEARCDWVIVAEDGYGVELTFRTFEVEEEADCGYDYMEAYDGYDSS
APRLGRFCGSGPLEEIYSAGDSLMIRFRTDDTINKKGFHARYTSTKFQDALHMKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8QEK5	0.628	0.646	0.000	986	0.699	0.719	A0A2R8QEK5.pdb.gz
2	AFDB:O43897	0.664	0.665	0.000	1013	0.722	0.724	O43897.pdb.gz	TLL1_HUMAN Tolloid-like protein 1 OS=Homo sapiens OX=9606 GN=TLL1 PE=1 SV=1
3	AFDB:O57460	0.650	0.647	0.000	1022	0.729	0.724	O57460.pdb.gz	TLL1_DANRE Dorsal-ventral patterning tolloid-like protein 1 OS=Danio rerio OX=7955 GN=tll1 PE=2 SV=1
4	AFDB:P25723	0.441	0.422	0.000	1067	0.420	0.399	P25723.pdb.gz	TLD_DROME Dorsal-ventral patterning protein tolloid OS=Drosophila melanogaster OX=7227 GN=tld PE=2 SV=2
5	AFDB:P98070	0.567	0.792	0.000	707	0.502	0.721	P98070.pdb.gz	BMP1_XENLA Bone morphogenetic protein 1 OS=Xenopus laevis OX=8355 GN=bmp1 PE=1 SV=1
6	AFDB:Q8JI28	0.651	0.656	0.000	1007	0.727	0.733	Q8JI28.pdb.gz	TLL1_XENLA Tolloid-like protein 1 OS=Xenopus laevis OX=8355 GN=tll1 PE=1 SV=1
7	AFDB:Q9VC47	0.577	0.410	0.000	1464	0.484	0.335	Q9VC47.pdb.gz	TOK_DROME Protein tolkin OS=Drosophila melanogaster OX=7227 GN=tok PE=1 SV=1
8	AFDB:Q9Y6L7	1.000	1.000	0.000	1015	1.000	1.000	Q9Y6L7.pdb.gz	TLL2_HUMAN Tolloid-like protein 2 OS=Homo sapiens OX=9606 GN=TLL2 PE=1 SV=1
9	AFDB:Q60997	0.121	0.071	1.941E-57	2085	0.190	0.093	Q60997.pdb.gz	DMBT1_MOUSE Deleted in malignant brain tumors 1 protein OS=Mus musculus OX=10090 GN=Dmbt1 PE=1 SV=2
10	AFDB:B3DFP6	0.125	0.135	2.738E-32	927	0.132	0.145	B3DFP6.pdb.gz
11	PDB:7b01A	0.098	0.154	3.494E-10	588	0.046	0.080	7b01A.pdb.gz	Crystal structure of ADAMTS13 CUB domains reveals their role in global latency.
12	PDB:7ufgA	0.090	0.081	6.068E-8	1151	0.098	0.086	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
13	PDB:4bxsV	0.072	0.062	1.875E-7	1262	0.065	0.052	4bxsV.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
14	PDB:8a7eC	0.082	0.059	3.769E-7	1524	0.095	0.063	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
15	PDB:1kcwA	0.057	0.057	1.046E-6	1017	0.077	0.077	1kcwA.pdb.gz	The X-ray structure of human serum ceruloplasmin at 3.1 angstrom: Nature of the copper centres.
16	PDB:7ufgB	0.090	0.080	1.889E-6	1182	0.094	0.080	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
17	PDB:3fu7B	0.058	0.089	4.707E-6	559	0.045	0.082	3fu7B.pdb.gz	Structure Function Studies of a Melanocarpus albomyces Laccase Suggest a Pathway for Oxidation of Phenolic Compounds.
18	PDB:7kveB	0.087	0.071	5.530E-6	1374	0.084	0.062	7kveB.pdb.gz
19	PDB:5n4lA	0.063	0.062	1.112E-5	1034	0.061	0.060	5n4lA.pdb.gz	Rat ceruloplasmin: a new labile copper binding site and zinc/copper mosaic.
20	PDB:2uxtA	0.059	0.120	2.235E-5	422	0.042	0.102	2uxtA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1M798	0.0	1573	990	0.724	0.742	F1M798_RAT Metalloendopeptidase OS=Rattus norvegicus OX=10116 GN=Bmp1 PE=4 SV=2
2	F1REM3	0.0	1538	976	0.698	0.725	F1REM3_DANRE Metalloendopeptidase OS=Danio rerio OX=7955 GN=bmp1a PE=4 SV=2
3	O43897	0.0	1570	1013	0.720	0.722	TLL1_HUMAN Tolloid-like protein 1 OS=Homo sapiens OX=9606 GN=TLL1 PE=1 SV=1
4	O57460	0.0	1598	1022	0.722	0.717	TLL1_DANRE Dorsal-ventral patterning tolloid-like protein 1 OS=Danio rerio OX=7955 GN=tll1 PE=2 SV=1
5	P13497	0.0	1563	986	0.717	0.738	BMP1_HUMAN Bone morphogenetic protein 1 OS=Homo sapiens OX=9606 GN=BMP1 PE=1 SV=2
6	P25723	0.0	835	1067	0.403	0.383	TLD_DROME Dorsal-ventral patterning protein tolloid OS=Drosophila melanogaster OX=7227 GN=tld PE=2 SV=2
7	P98063	0.0	1570	991	0.720	0.738	BMP1_MOUSE Bone morphogenetic protein 1 OS=Mus musculus OX=10090 GN=Bmp1 PE=1 SV=2
8	P98070	0.0	1088	707	0.503	0.723	BMP1_XENLA Bone morphogenetic protein 1 OS=Xenopus laevis OX=8355 GN=bmp1 PE=1 SV=1
9	Q2ABP1	0.0	1530	986	0.696	0.716	Q2ABP1_DANRE Metalloendopeptidase OS=Danio rerio OX=7955 GN=bmp1a PE=2 SV=1
10	Q62381	0.0	1535	1013	0.697	0.698	TLL1_MOUSE Tolloid-like protein 1 OS=Mus musculus OX=10090 GN=Tll1 PE=1 SV=1
11	Q8JI28	0.0	1589	1007	0.718	0.724	TLL1_XENLA Tolloid-like protein 1 OS=Xenopus laevis OX=8355 GN=tll1 PE=1 SV=1
12	Q9VC47	0.0	986	1464	0.458	0.318	TOK_DROME Protein tolkin OS=Drosophila melanogaster OX=7227 GN=tok PE=1 SV=1
13	Q9WVM6	0.0	1897	1012	0.888	0.890	TLL2_MOUSE Tolloid-like protein 2 OS=Mus musculus OX=10090 GN=Tll2 PE=1 SV=1
14	Q9Y6L7	0.0	2123	1015	1.000	1.000	TLL2_HUMAN Tolloid-like protein 2 OS=Homo sapiens OX=9606 GN=TLL2 PE=1 SV=1
15	Q49IJ0	7.19e-124	386	422	0.181	0.436	Q49IJ0_DROME Metalloendopeptidase (Fragment) OS=Drosophila melanogaster OX=7227 GN=tok PE=4 SV=1
16	Q49IK4	7.74e-124	385	422	0.181	0.436	Q49IK4_DROME Metalloendopeptidase (Fragment) OS=Drosophila melanogaster OX=7227 GN=tok PE=4 SV=1
17	Q49II8	8.08e-124	385	422	0.181	0.436	Q49II8_DROME Metalloendopeptidase (Fragment) OS=Drosophila melanogaster OX=7227 GN=tok PE=4 SV=1
18	Q49II5	9.08e-124	385	422	0.181	0.436	Q49II5_DROME Metalloendopeptidase (Fragment) OS=Drosophila melanogaster OX=7227 GN=tok PE=4 SV=1
19	Q49IJ1	1.03e-123	385	422	0.181	0.436	Q49IJ1_DROME Metalloendopeptidase (Fragment) OS=Drosophila melanogaster OX=7227 GN=tok PE=4 SV=1
20	Q49II0	1.37e-123	385	422	0.181	0.436	Q49II0_DROME Metalloendopeptidase (Fragment) OS=Drosophila melanogaster OX=7227 GN=tok PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01400 Astacin	4e-69	243.6	Astacin (Peptidase family M12A)
2	PF12662 cEGF	2e-05	35.7	Complement Clr-like EGF-like
3	PF00431 CUB	1.1e-182	606.8	CUB domain
4	PF02408 CUB_2	0.022	25.9	CUB-like domain
5	PF12079 DUF3558	82	14.6	Protein of unknown function (DUF3558)
6	PF00008 EGF	0.0002	32.9	EGF-like domain
7	PF12947 EGF_3	0.031	25.8	EGF domain
8	PF07645 EGF_CA	6.4e-10	50.4	Calcium-binding EGF domain
9	PF12946 EGF_MSP1_1	50	15.3	MSP1 EGF domain 1
10	PF14670 FXa_inhibition	8.6e-12	56.5	Coagulation Factor Xa inhibitory site
11	PF12661 hEGF	5.9	18.9	Human growth factor-like EGF
12	PF00413 Peptidase_M10	1.3e+02	13.8	Matrixin
13	PF13583 Reprolysin_4	2.4	19.3	Metallo-peptidase family M12B Reprolysin-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000350630

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000204604	0.946	Chordin
2	9606.ENSP00000348385	0.921	Collagen alpha-1(XXVII) chain
3	9606.ENSP00000359603	0.921	Collagen alpha-1(XXIV) chain
4	9606.ENSP00000364000	0.916	Collagen alpha-2(V) chain
5	9606.ENSP00000363827	0.914	Basement membrane-specific heparan sulfate proteoglycan core protein
6	9606.ENSP00000225964	0.912	Collagen alpha-1(I) chain
7	9606.ENSP00000297268	0.912	Collagen alpha-2(I) chain
8	9606.ENSP00000260702	0.910	Lysyl oxidase homolog 4
9	9606.ENSP00000231004	0.907	Protein-lysine 6-oxidase
10	9606.ENSP00000373783	0.907	Lysyl oxidase homolog 2
11	9606.ENSP00000359114	0.906	Collagen alpha-1(XI) chain
12	9606.ENSP00000304408	0.905	Collagen alpha-1(III) chain
13	9606.ENSP00000332371	0.905	Collagen alpha-1(VII) chain
14	9606.ENSP00000360882	0.905	Collagen alpha-1(V) chain
15	9606.ENSP00000363840	0.905	Collagen alpha-2(XI) chain
16	9606.ENSP00000369889	0.905	Collagen alpha-1(II) chain
17	9606.ENSP00000261921	0.904	Lysyl oxidase homolog 1
18	9606.ENSP00000264094	0.901	Lysyl oxidase homolog 3
19	9606.ENSP00000264828	0.901	Collagen alpha-3(V) chain
20	9606.ENSP00000223061	0.829	Procollagen C-endopeptidase enhancer 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004175	0.999	endopeptidase activity
GO:0005515	0.998	protein binding
GO:0008236	0.968	serine-type peptidase activity
GO:0004252	0.950	serine-type endopeptidase activity
GO:0008237	0.939	metallopeptidase activity
GO:0004222	0.894	metalloendopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0048856	0.961	anatomical structure development
GO:0065007	0.955	biological regulation
GO:0050789	0.953	regulation of biological process
GO:0032501	0.929	multicellular organismal process
GO:0045229	0.926	external encapsulating structure organization
GO:0043062	0.926	extracellular structure organization
GO:0030198	0.907	extracellular matrix organization
GO:0030199	0.891	collagen fibril organization
GO:0008152	0.863	metabolic process
GO:0007275	0.857	multicellular organism development
GO:1901564	0.770	organonitrogen compound metabolic process
GO:0050793	0.734	regulation of developmental process
GO:0050794	0.685	regulation of cellular process
GO:0044238	0.682	primary metabolic process
GO:0048731	0.681	system development
GO:0043170	0.605	macromolecule metabolic process
GO:0019538	0.582	protein metabolic process
GO:0048519	0.531	negative regulation of biological process
GO:0048513	0.398	animal organ development
GO:0048518	0.336	positive regulation of biological process
GO:0009888	0.313	tissue development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0043227	0.815	membrane-bounded organelle
GO:0005615	0.769	extracellular space
GO:0071944	0.604	cell periphery
GO:0005622	0.425	intracellular anatomical structure
GO:0043229	0.394	intracellular organelle
GO:0043231	0.383	intracellular membrane-bounded organelle
GO:0070013	0.372	intracellular organelle lumen
GO:0012505	0.370	endomembrane system
GO:0005737	0.342	cytoplasm
GO:0031982	0.308	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	0.999	Acting on peptide bonds (peptidases).
EC:3.4.21.-	0.950	Serine endopeptidases.
EC:3.4.24.-	0.894	Metalloendopeptidases.

[back to server]