StarFunc result for job id Q9Y6M1

User Input

>input (599 residues)
MMNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQVLLKSGYAFVDYPDQNWAIRAIETLSG
KVELHGKIMEVDYSVSKKLRSRKIQIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTET
AVVNVTYATREEAKIAMEKLSGHQFENYSFKISYIPDEEVSSPSPPQRAQRGDHSSREQG
HAPGGTSQARQIDFPLRILVPTQFVGAIIGKEGLTIKNITKQTQSRVDIHRKENSGAAEK
PVTIHATPEGTSEACRMILEIMQKEADETKLAEEIPLKILAHNGLVGRLIGKEGRNLKKI
EHETGTKITISSLQDLSIYNPERTITVKGTVEACASAEIEIMKKLREAFENDMLAVNQQA
NLIPGLNLSALGIFSTGLSVLSPPAGPRGAPPAAPYHPFTTHSGYFSSLYPHHQFGPFPH
HHSYPEQEIVNLFIPTQAVGAIIGKKGAHIKQLARFAGASIKIAPAEGPDVSERMVIITG
PPEAQFKAQGRIFGKLKEENFFNPKEEVKLEAHIRVPSSTAGRVIGKGGKTVNELQNLTS
AEVIVPRDQTPDENEEVIVRIIGHFFASQTAQRKIREIVQQVKQQEQKYPQGVASQRSK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y6M1	1.000	1.000	0.000	599	1.000	1.000	Q9Y6M1.pdb.gz	IF2B2_HUMAN Insulin-like growth factor 2 mRNA-binding protein 2 OS=Homo sapiens OX=9606 GN=IGF2BP2 PE=1 SV=2
2	AFDB:O73932	0.738	0.744	8.155E-92	594	0.664	0.670	O73932.pdb.gz	IF23A_XENLA Insulin-like growth factor 2 mRNA-binding protein 3-A OS=Xenopus laevis OX=8355 GN=igf2bp3-a PE=1 SV=1
3	AFDB:O88477	0.647	0.669	1.473E-91	577	0.651	0.676	O88477.pdb.gz	IF2B1_MOUSE Insulin-like growth factor 2 mRNA-binding protein 1 OS=Mus musculus OX=10090 GN=Igf2bp1 PE=1 SV=1
4	AFDB:Q08CK7	0.723	0.725	2.508E-91	598	0.648	0.649	Q08CK7.pdb.gz	IF2B1_DANRE Insulin-like growth factor 2 mRNA-binding protein 1 OS=Danio rerio OX=7955 GN=igf2bp1 PE=1 SV=1
5	AFDB:O00425	0.771	0.796	7.712E-91	579	0.639	0.661	O00425.pdb.gz	IF2B3_HUMAN Insulin-like growth factor 2 mRNA-binding protein 3 OS=Homo sapiens OX=9606 GN=IGF2BP3 PE=1 SV=2
6	AFDB:Q9PW80	0.711	0.731	1.568E-90	582	0.651	0.670	Q9PW80.pdb.gz	IF2B3_DANRE Insulin-like growth factor 2 mRNA-binding protein 3 OS=Danio rerio OX=7955 GN=igf2bp3 PE=1 SV=1
7	AFDB:M9NF14	0.376	0.359	1.664E-53	638	0.357	0.335	M9NF14.pdb.gz	M9NF14_DROME IGF-II mRNA-binding protein, isoform L OS=Drosophila melanogaster OX=7227 GN=Imp PE=1 SV=1
8	AFDB:Q0WNX3	0.310	0.333	9.437E-28	548	0.165	0.181	Q0WNX3.pdb.gz	Q0WNX3_ARATH RNA-binding KH domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=At5g15270 PE=1 SV=1
9	AFDB:Q9XI71	0.247	0.298	3.089E-26	479	0.150	0.188	Q9XI71.pdb.gz	Q9XI71_ARATH F7A19.25 protein OS=Arabidopsis thaliana OX=3702 GN=At1g14170 PE=1 SV=1
10	AFDB:A0A178WDD2	0.245	0.237	1.134E-25	621	0.164	0.158	A0A178WDD2.pdb.gz	A0A178WDD2_ARATH (thale cress) hypothetical protein OS=Arabidopsis thaliana OX=3702 GN=At1g51580 PE=1 SV=1
11	PDB:5lsbA	0.121	0.394	1.999E-10	176	0.060	0.205	5lsbA.pdb.gz
12	PDB:5vsuA	0.134	0.198	5.461E-10	387	0.068	0.106	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
13	PDB:6y5qq	0.115	0.359	2.859E-9	178	0.053	0.180	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
14	PDB:7oqcF	0.123	0.264	5.813E-9	267	0.053	0.120	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
15	PDB:6y53o	0.119	0.407	3.425E-8	160	0.053	0.200	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
16	PDB:7evoD	0.114	0.328	4.603E-8	200	0.058	0.175	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
17	PDB:6r5kH	0.130	0.188	2.279E-6	394	0.060	0.091	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
18	PDB:6ff7X	0.109	0.352	3.880E-6	171	0.062	0.216	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
19	PDB:7dvqI	0.137	0.581	1.060E-5	128	0.032	0.148	7dvqI.pdb.gz	Structure of the activated human minor spliceosome.
20	PDB:3lqvB	0.124	0.605	3.669E-5	115	0.037	0.191	3lqvB.pdb.gz	Branch Recognition by SF3b14

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00425	0.0	769	579	0.643	0.665	IF2B3_HUMAN Insulin-like growth factor 2 mRNA-binding protein 3 OS=Homo sapiens OX=9606 GN=IGF2BP3 PE=1 SV=2
2	O42254	0.0	797	576	0.669	0.696	IF2B1_CHICK Insulin-like growth factor 2 mRNA-binding protein 1 OS=Gallus gallus OX=9031 GN=IGF2BP1 PE=1 SV=1
3	O73932	0.0	776	594	0.661	0.667	IF23A_XENLA Insulin-like growth factor 2 mRNA-binding protein 3-A OS=Xenopus laevis OX=8355 GN=igf2bp3-a PE=1 SV=1
4	O88477	0.0	781	577	0.654	0.679	IF2B1_MOUSE Insulin-like growth factor 2 mRNA-binding protein 1 OS=Mus musculus OX=10090 GN=Igf2bp1 PE=1 SV=1
5	Q08CK7	0.0	789	598	0.658	0.659	IF2B1_DANRE Insulin-like growth factor 2 mRNA-binding protein 1 OS=Danio rerio OX=7955 GN=igf2bp1 PE=1 SV=1
6	Q5SF07	0.0	1129	592	0.947	0.958	IF2B2_MOUSE Insulin-like growth factor 2 mRNA-binding protein 2 OS=Mus musculus OX=10090 GN=Igf2bp2 PE=1 SV=1
7	Q8CGX0	0.0	782	577	0.656	0.681	IF2B1_RAT Insulin-like growth factor 2 mRNA-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Igf2bp1 PE=1 SV=1
8	Q9CPN8	0.0	758	579	0.643	0.665	IF2B3_MOUSE Insulin-like growth factor 2 mRNA-binding protein 3 OS=Mus musculus OX=10090 GN=Igf2bp3 PE=1 SV=1
9	Q9NZI8	0.0	784	577	0.658	0.683	IF2B1_HUMAN Insulin-like growth factor 2 mRNA-binding protein 1 OS=Homo sapiens OX=9606 GN=IGF2BP1 PE=1 SV=2
10	Q9PW80	0.0	779	582	0.656	0.675	IF2B3_DANRE Insulin-like growth factor 2 mRNA-binding protein 3 OS=Danio rerio OX=7955 GN=igf2bp3 PE=1 SV=1
11	Q9Y6M1	0.0	1228	599	1.000	1.000	IF2B2_HUMAN Insulin-like growth factor 2 mRNA-binding protein 2 OS=Homo sapiens OX=9606 GN=IGF2BP2 PE=1 SV=2
12	Q0KHU2	2.03e-110	346	631	0.351	0.333	Q0KHU2_DROME IGF-II mRNA-binding protein, isoform K OS=Drosophila melanogaster OX=7227 GN=Imp PE=1 SV=2
13	M9NF14	3.60e-110	345	638	0.351	0.329	M9NF14_DROME IGF-II mRNA-binding protein, isoform L OS=Drosophila melanogaster OX=7227 GN=Imp PE=1 SV=1
14	Q8IGK4	9.21e-101	319	580	0.319	0.329	Q8IGK4_DROME RE72930p OS=Drosophila melanogaster OX=7227 GN=Imp PE=2 SV=1
15	Q9VZ69	1.23e-100	318	566	0.317	0.336	Q9VZ69_DROME IGF-II mRNA-binding protein OS=Drosophila melanogaster OX=7227 GN=Imp PE=1 SV=2
16	E1JJM0	1.67e-100	318	580	0.319	0.329	E1JJM0_DROME FI20063p1 OS=Drosophila melanogaster OX=7227 GN=Imp PE=1 SV=1
17	Q8IR99	2.76e-100	318	573	0.317	0.332	Q8IR99_DROME IGF-II mRNA-binding protein, isoform D OS=Drosophila melanogaster OX=7227 GN=Imp PE=1 SV=1
18	O74919	4.64e-18	89.0	398	0.150	0.226	RNC1_SCHPO RNA-binding protein rnc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rnc1 PE=1 SV=1
19	Q0WNX3	7.82e-18	89.4	548	0.172	0.188	Q0WNX3_ARATH RNA-binding KH domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=At5g15270 PE=1 SV=1
20	P60335	5.40e-14	75.9	356	0.090	0.152	PCBP1_MOUSE Poly(rC)-binding protein 1 OS=Mus musculus OX=10090 GN=Pcbp1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00013 KH_1	4e-51	182.0	KH domain
2	PF07650 KH_2	1.3e-13	61.9	KH domain
3	PF13083 KH_4	2.5e-11	54.6	KH domain
4	PF13184 KH_5	0.85	21.1	NusA-like KH domain
5	PF16005 MOEP19	0.031	25.6	KH-like RNA-binding domain
6	PF00076 RRM_1	8.4e-14	62.5	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
7	PF13893 RRM_5	1.2	20.3	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000371634

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000274695	0.871	Threonylcarbamoyladenosine tRNA methylthiotransferase
2	9606.ENSP00000415011	0.841	Zinc transporter 8
3	9606.ENSP00000282728	0.826	Hematopoietically-expressed homeobox protein HHEX
4	9606.ENSP00000358404	0.825	Transcription factor 7-like 2
5	9606.ENSP00000437621	0.796	High mobility group protein HMGI-C
6	9606.ENSP00000345708	0.757	ATP-sensitive inward rectifier potassium channel 11
7	9606.ENSP00000418823	0.752	Alpha-ketoglutarate-dependent dioxygenase FTO
8	9606.ENSP00000290341	0.741	Insulin-like growth factor 2 mRNA-binding protein 1
9	9606.ENSP00000283928	0.738	Juxtaposed with another zinc finger protein 1
10	9606.ENSP00000281141	0.735	Cell division cycle protein 123 homolog
11	9606.ENSP00000226760	0.710	Wolframin
12	9606.ENSP00000257068	0.710	Melatonin receptor type 1B
13	9606.ENSP00000385995	0.710	Thyroid adenoma-associated protein
14	9606.ENSP00000155840	0.689	Potassium voltage-gated channel subfamily KQT member 1
15	9606.ENSP00000377003	0.681	Tetraspanin-8
16	9606.ENSP00000391826	0.673	Insulin-like growth factor II
17	9606.ENSP00000478874	0.672	Calcium/calmodulin-dependent protein kinase type 1D
18	9606.ENSP00000418735	0.668	A disintegrin and metalloproteinase with thrombospondin motifs 9
19	9606.ENSP00000349541	0.637	Caveolae-associated protein 1
20	9606.ENSP00000361626	0.637	Nuclease-sensitive element-binding protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003730	1.000	mRNA 3'-UTR binding
GO:0048027	0.999	mRNA 5'-UTR binding
GO:1990247	0.979	N6-methyladenosine-containing RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048519	0.989	negative regulation of biological process
GO:0080090	0.989	regulation of primary metabolic process
GO:0051171	0.989	regulation of nitrogen compound metabolic process
GO:0031323	0.989	regulation of cellular metabolic process
GO:0010468	0.989	regulation of gene expression
GO:0048523	0.984	negative regulation of cellular process
GO:0010605	0.979	negative regulation of macromolecule metabolic process
GO:0048518	0.975	positive regulation of biological process
GO:0051172	0.971	negative regulation of nitrogen compound metabolic process
GO:0009987	0.966	cellular process
GO:0010608	0.963	post-transcriptional regulation of gene expression
GO:0031324	0.952	negative regulation of cellular metabolic process
GO:1903311	0.948	regulation of mRNA metabolic process
GO:1903312	0.943	negative regulation of mRNA metabolic process
GO:0043488	0.935	regulation of mRNA stability
GO:1902369	0.935	negative regulation of RNA catabolic process
GO:0032501	0.928	multicellular organismal process
GO:0043489	0.928	RNA stabilization
GO:1902373	0.917	negative regulation of mRNA catabolic process
GO:0048255	0.914	mRNA stabilization
GO:0010629	0.901	negative regulation of gene expression
GO:0009889	0.872	regulation of biosynthetic process
GO:0008152	0.857	metabolic process
GO:0010556	0.857	regulation of macromolecule biosynthetic process
GO:0006417	0.852	regulation of translation
GO:2000113	0.847	negative regulation of cellular macromolecule biosynthetic process
GO:0034249	0.846	negative regulation of amide metabolic process
GO:0032502	0.841	developmental process
GO:0017148	0.841	negative regulation of translation
GO:0048856	0.801	anatomical structure development
GO:0048522	0.798	positive regulation of cellular process
GO:0044238	0.728	primary metabolic process
GO:0071704	0.667	organic substance metabolic process
GO:0044237	0.660	cellular metabolic process
GO:0051239	0.600	regulation of multicellular organismal process
GO:0050896	0.557	response to stimulus
GO:0006807	0.538	nitrogen compound metabolic process
GO:0043170	0.465	macromolecule metabolic process
GO:0001817	0.455	regulation of cytokine production
GO:0051173	0.431	positive regulation of nitrogen compound metabolic process
GO:0034641	0.412	cellular nitrogen compound metabolic process
GO:0031325	0.389	positive regulation of cellular metabolic process
GO:0071840	0.326	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0005829	0.993	cytosol
GO:0005634	0.990	nucleus
GO:0032991	0.974	protein-containing complex
GO:0043232	0.971	intracellular non-membrane-bounded organelle
GO:0070013	0.954	intracellular organelle lumen
GO:0031981	0.897	nuclear lumen
GO:0099080	0.839	supramolecular complex
GO:0005654	0.835	nucleoplasm
GO:0035770	0.772	ribonucleoprotein granule
GO:0036464	0.723	cytoplasmic ribonucleoprotein granule
GO:0010494	0.701	cytoplasmic stress granule
GO:0000932	0.515	P-body
GO:1990904	0.426	ribonucleoprotein complex
GO:0005856	0.317	cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]