StarFunc result for job id Q9Y6M7

User Input

>input (1214 residues)
MERFRLEKKLPGPDEEAVVDLGKTSSTVNTKFEKEELESHRAVYIGVHVPFSKESRRRHR
HRGHKHHHRRRKDKESDKEDGRESPSYDTPSQRVQFILGTEDDDEEHIPHDLFTEMDELC
YRDGEEYEWKETARWLKFEEDVEDGGDRWSKPYVATLSLHSLFELRSCILNGTVMLDMRA
STLDEIADMVLDNMIASGQLDESIRENVREALLKRHHHQNEKRFTSRIPLVRSFADIGKK
HSDPHLLERNGEGLSASRHSLRTGLSASNLSLRGESPLSLLLGHLLPSSRAGTPAGSRCT
TPVPTPQNSPPSSPSISRLTSRSSQESQRQAPELLVSPASDDIPTVVIHPPEEDLEAALK
GEEQKNEENVDLTPGILASPQSAPGNLDNSKSGEIKGNGSGGSRENSTVDFSKVDMNFMR
KIPTGAEASNVLVGEVDFLERPIIAFVRLAPAVLLTGLTEVPVPTRFLFLLLGPAGKAPQ
YHEIGRSIATLMTDEIFHDVAYKAKDRNDLLSGIDEFLDQVTVLPPGEWDPSIRIEPPKS
VPSQEKRKIPVFHNGSTPTLGETPKEAAHHAGPELQRTGRLFGGLILDIKRKAPFFLSDF
KDALSLQCLASILFLYCACMSPVITFGGLLGEATEGRISAIESLFGASLTGIAYSLFAGQ
PLTILGSTGPVLVFEKILYKFCRDYQLSYLSLRTSIGLWTSFLCIVLVATDASSLVCYIT
RFTEEAFAALICIIFIYEALEKLFDLGETYAFNMHNNLDKLTSYSCVCTEPPNPSNETLA
QWKKDNITAHNISWRNLTVSECKKLRGVFLGSACGHHGPYIPDVLFWCVILFFTTFFLSS
FLKQFKTKRYFPTKVRSTISDFAVFLTIVIMVTIDYLVGVPSPKLHVPEKFEPTHPERGW
IISPLGDNPWWTLLIAAIPALLCTILIFMDQQITAVIINRKEHKLKKGAGYHLDLLMVGV
MLGVCSVMGLPWFVAATVLSISHVNSLKVESECSAPGEQPKFLGIREQRVTGLMIFILMG
LSVFMTSVLKFIPMPVLYGVFLYMGVSSLKGIQLFDRIKLFGMPAKHQPDLIYLRYVPLW
KVHIFTVIQLTCLVLLWVIKVSAAAVVFPMMVLALVFVRKLMDLCFTKRELSWLDDLMPE
SKKKKEDDKKKKEKEEAERMLQDDDDTVHLPFEGGSLLQIPVKALKYSPDKPVSVKISFE
DEPRKKYVDAETSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5DTL9	0.724	0.783	0.000	1118	0.655	0.711	Q5DTL9.pdb.gz	S4A10_MOUSE Sodium-driven chloride bicarbonate exchanger OS=Mus musculus OX=10090 GN=Slc4a10 PE=1 SV=2
2	AFDB:Q8BTY2	0.526	0.598	0.000	1034	0.762	0.895	Q8BTY2.pdb.gz	S4A7_MOUSE Sodium bicarbonate cotransporter 3 OS=Mus musculus OX=10090 GN=Slc4a7 PE=1 SV=2
3	AFDB:Q9R1N3	0.754	0.752	0.000	1218	0.930	0.927	Q9R1N3.pdb.gz	S4A7_RAT Sodium bicarbonate cotransporter 3 OS=Rattus norvegicus OX=10116 GN=Slc4a7 PE=1 SV=1
4	AFDB:A0A2R8PYB9	0.462	0.501	5.553E-98	1114	0.493	0.537	A0A2R8PYB9.pdb.gz
5	AFDB:F1QHT2	0.609	0.675	5.366E-96	1082	0.479	0.538	F1QHT2.pdb.gz
6	AFDB:O88343	0.604	0.672	5.420E-94	1079	0.477	0.537	O88343.pdb.gz	S4A4_MOUSE Electrogenic sodium bicarbonate cotransporter 1 OS=Mus musculus OX=10090 GN=Slc4a4 PE=1 SV=2
7	AFDB:M9PC95	0.587	0.672	5.695E-93	1046	0.437	0.508	M9PC95.pdb.gz	M9PC95_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
8	AFDB:O13134	0.607	0.700	2.254E-92	1035	0.451	0.529	O13134.pdb.gz	S4A4_AMBTI Electrogenic sodium bicarbonate cotransporter 1 OS=Ambystoma tigrinum OX=8305 GN=SLC4A4 PE=2 SV=1
9	AFDB:Q9BY07	0.481	0.512	1.164E-91	1137	0.435	0.464	Q9BY07.pdb.gz	S4A5_HUMAN Electrogenic sodium bicarbonate cotransporter 4 OS=Homo sapiens OX=9606 GN=SLC4A5 PE=2 SV=2
10	AFDB:G5EDF4	0.641	0.668	3.603E-87	1161	0.415	0.434	G5EDF4.pdb.gz	G5EDF4_CAEEL Anion exchange protein OS=Caenorhabditis elegans OX=6239 GN=abts-1 PE=1 SV=1
11	PDB:8cs9g	0.416	0.600	1.638E-56	832	0.267	0.389	8cs9g.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
12	PDB:7tvzA	0.470	0.636	4.019E-54	850	0.272	0.388	7tvzA.pdb.gz	Structure, dynamics and assembly of the ankyrin complex on human red blood cell membrane.
13	PDB:6caaA	0.371	0.922	4.424E-35	477	0.236	0.600	6caaA.pdb.gz
14	PDB:4yzfA	0.376	0.949	1.180E-33	475	0.169	0.432	4yzfA.pdb.gz	Crystal structure of the anion exchanger domain of human erythrocyte band 3.
15	PDB:5l25A	0.283	0.790	1.365E-13	399	0.087	0.266	5l25A.pdb.gz
16	PDB:7lguA	0.274	0.460	6.297E-9	680	0.064	0.115	7lguA.pdb.gz	Molecular mechanism of prestin electromotive signal amplification.
17	PDB:7ch1A	0.240	0.406	4.102E-6	640	0.058	0.109	7ch1A.pdb.gz	Structural insights into the gating mechanism of human SLC26A9 mediated by its C-terminal sequence.
18	PDB:5i6cA	0.239	0.510	1.047E-4	480	0.048	0.121	5i6cA.pdb.gz	Structure of eukaryotic purine/H(+) symporter UapA suggests a role for homodimerization in transport activity.
19	PDB:3qe7A	0.227	0.567	5.910E-4	407	0.052	0.155	3qe7A.pdb.gz	Structure and mechanism of the uracil transporter UraA
20	PDB:7s1xB	0.072	0.086	1.263E-2	871	0.061	0.085	7s1xB.pdb.gz	Structural basis for inhibition of the Cation-chloride cotransporter NKCC1 by the diuretic drug bumetanide

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A096X8J7	587	1170	0.264	0.274	B3A3_DANRE Anion exchange protein 3 OS=Danio rerio OX=7955 GN=Slc4a3 PE=2 SV=1
2	A0A2R8QD45	894	1073	0.369	0.418	A0A2R8QD45_DANRE Anion exchange protein OS=Danio rerio OX=7955 GN=id:ibd2520 PE=1 SV=1
3	A0A494BA31	690	952	0.315	0.402	B3A4_MOUSE Anion exchange protein 4 OS=Mus musculus OX=10090 GN=Slc4a9 PE=1 SV=1
4	A0A494BAK5	682	821	0.305	0.451	A0A494BAK5_MOUSE Anion exchange protein (Fragment) OS=Mus musculus OX=10090 GN=Slc4a9 PE=3 SV=1
5	A0A494BBC3	631	918	0.300	0.397	A0A494BBC3_MOUSE Anion exchange protein OS=Mus musculus OX=10090 GN=Slc4a9 PE=3 SV=1
6	A9NIM6	577	1232	0.258	0.254	A9NIM6_DANRE Anion exchange protein OS=Danio rerio OX=7955 GN=slc4a2.1 PE=1 SV=1
7	B3WFV9	822	1215	0.347	0.347	B3WFV9_CAEEL Anion exchange protein OS=Caenorhabditis elegans OX=6239 GN=abts-1 PE=1 SV=2
8	E9PUP3	642	929	0.301	0.394	E9PUP3_MOUSE Anion exchange protein OS=Mus musculus OX=10090 GN=Slc4a9 PE=3 SV=1
9	E9Q3M5	832	1116	0.329	0.358	S4A5_MOUSE Electrogenic sodium bicarbonate cotransporter 4 OS=Mus musculus OX=10090 GN=Slc4a5 PE=1 SV=1
10	G5EC65	824	1119	0.347	0.376	G5EC65_CAEEL Anion exchange protein OS=Caenorhabditis elegans OX=6239 GN=abts-1 PE=1 SV=1
11	G5EDF4	824	1161	0.347	0.363	G5EDF4_CAEEL Anion exchange protein OS=Caenorhabditis elegans OX=6239 GN=abts-1 PE=1 SV=1
12	M9PB59	852	1134	0.354	0.379	M9PB59_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
13	M9PB60	849	1126	0.348	0.375	M9PB60_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
14	M9PC92	848	1086	0.348	0.389	M9PC92_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
15	M9PC95	1023	1046	0.441	0.511	M9PC95_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
16	M9PCF0	851	1067	0.355	0.404	M9PCF0_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
17	M9PCT2	848	1027	0.353	0.418	M9PCT2_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
18	M9PF01	852	1053	0.354	0.408	M9PF01_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
19	O13134	899	1035	0.363	0.426	S4A4_AMBTI Electrogenic sodium bicarbonate cotransporter 1 OS=Ambystoma tigrinum OX=8305 GN=SLC4A4 PE=2 SV=1
20	O88343	903	1079	0.372	0.419	S4A4_MOUSE Electrogenic sodium bicarbonate cotransporter 1 OS=Mus musculus OX=10090 GN=Slc4a4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07565 Band_3_cyto	4.9e-102	352.8	Band 3 cytoplasmic domain
2	PF00955 HCO3_cotransp	8.6e-230	775.4	HCO3- transporter family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000295736

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000005226	0.956	Harmonin
2	9606.ENSP00000262613	0.956	Na(+)/H(+) exchange regulatory cofactor NHE-RF1
3	9606.ENSP00000358814	0.850	S-adenosylhomocysteine hydrolase-like protein 1
4	9606.ENSP00000382428	0.756	Disks large homolog 4
5	9606.ENSP00000263980	0.740	Sodium/hydrogen exchanger 1
6	9606.ENSP00000003084	0.738	Cystic fibrosis transmembrane conductance regulator
7	9606.ENSP00000384582	0.737	G-protein coupled receptor 98
8	9606.ENSP00000378306	0.705	Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform
9	9606.ENSP00000033079	0.692	Protein FAM13B
10	9606.ENSP00000219746	0.684	TOX high mobility group box family member 3
11	9606.ENSP00000264938	0.676	Sodium/hydrogen exchanger 3
12	9606.ENSP00000367608	0.666	Carbonic anhydrase 9
13	9606.ENSP00000378920	0.657	Solute carrier family 26 member 6
14	9606.ENSP00000305941	0.655	Usherin
15	9606.ENSP00000371194	0.651	Lymphocyte-specific protein 1
16	9606.ENSP00000285379	0.650	Carbonic anhydrase 2
17	9606.ENSP00000329932	0.638	Galectin-9C
18	9606.ENSP00000343847	0.632	Serine/threonine-protein kinase Nek10
19	9606.ENSP00000262461	0.626	Solute carrier family 12 member 2
20	9606.ENSP00000284885	0.607	Enteropeptidase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008510	1.000	sodium:bicarbonate symporter activity
GO:0005515	0.998	protein binding
GO:0015103	0.852	inorganic anion transmembrane transporter activity
GO:0015297	0.769	antiporter activity
GO:0005452	0.494	solute:inorganic anion antiporter activity
GO:0008509	0.441	monoatomic anion transmembrane transporter activity
GO:0015108	0.396	chloride transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.993	biological regulation
GO:0009987	0.976	cellular process
GO:0006810	0.965	transport
GO:0042592	0.858	homeostatic process
GO:0050801	0.827	monoatomic ion homeostasis
GO:0006885	0.757	regulation of pH
GO:0071702	0.673	organic substance transport
GO:0019725	0.482	cellular homeostasis
GO:0055082	0.469	intracellular chemical homeostasis
GO:0030003	0.453	intracellular monoatomic cation homeostasis
GO:0050789	0.439	regulation of biological process
GO:0030641	0.431	regulation of cellular pH
GO:0050794	0.358	regulation of cellular process
GO:0019755	0.331	one-carbon compound transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0098590	0.994	plasma membrane region
GO:0009925	0.902	basal plasma membrane
GO:0016323	0.878	basolateral plasma membrane
GO:0043226	0.766	organelle
GO:0005622	0.680	intracellular anatomical structure
GO:0043227	0.675	membrane-bounded organelle
GO:0005737	0.666	cytoplasm
GO:0043229	0.647	intracellular organelle
GO:0045177	0.335	apical part of cell

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:28695	1.000	hydrogencarbonate(in) = hydrogencarbonate(out)
RHEA:34963	1.000	Na(+)(in) = Na(+)(out)
RHEA:29823	0.396	chloride(in) = chloride(out)

[back to server]