StarFunc result for job id Q9Y6M9

User Input

>input (179 residues)
MAFLASGPYLTHQQKVLRLYKRALRHLESWCVQRDKYRYFACLMRARFEEHKNEKDMAKA
TQLLKEAEEEFWYRQHPQPYIFPDSPGGTSYERYDCYKVPEWCLDDWHPSEKAMYPDYFA
KREQWKKLRRESWEREVKQLQEETPPGGPLTEALPPARKEGDLPPLWWYIVTRPRERPM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q02369	0.997	0.997	7.409E-31	179	0.911	0.911	Q02369.pdb.gz	NDUB9_BOVIN NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 OS=Bos taurus OX=9913 GN=NDUFB9 PE=1 SV=2
2	AFDB:Q9CQJ8	0.975	0.975	3.682E-29	179	0.866	0.866	Q9CQJ8.pdb.gz	NDUB9_MOUSE NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 OS=Mus musculus OX=10090 GN=Ndufb9 PE=1 SV=3
3	PDB:7qsdn	0.949	0.987	1.252E-26	172	0.877	0.913	7qsdn.pdb.gz	Structural basis of mammalian respiratory complex I inhibition by medicinal biguanides.
4	PDB:7b93n	0.955	0.960	2.351E-26	178	0.860	0.865	7b93n.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
5	AFDB:E7EWZ0	0.779	0.784	1.487E-21	178	0.788	0.792	E7EWZ0.pdb.gz	E7EWZ0_HUMAN NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 OS=Homo sapiens OX=9606 GN=NDUFB9 PE=1 SV=1
6	AFDB:Q945M1	0.448	0.680	9.694E-6	117	0.145	0.222	Q945M1.pdb.gz	NDUB9_ARATH NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 OS=Arabidopsis thaliana OX=3702 GN=CIB22 PE=1 SV=1
7	PDB:7aqwn	0.434	0.699	1.137E-5	109	0.145	0.239	7aqwn.pdb.gz	A ferredoxin bridge connects the two arms of plant mitochondrial complex I.
8	PDB:6uxeB	0.313	0.622	1.495E-2	85	0.101	0.212	6uxeB.pdb.gz	The essential function of ISCU2 and its conserved N-terminus in Fe/S cluster biogenesis
9	AFDB:Q8SZ16	0.304	0.435	2.550E-2	120	0.084	0.125	Q8SZ16.pdb.gz	SDHF3_DROME Succinate dehydrogenase assembly factor 3, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Sdhaf3 PE=2 SV=1
10	AFDB:Q57Z79	0.318	0.266	5.099E-2	216	0.101	0.083	Q57Z79.pdb.gz	Q57Z79_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.27M3.150 PE=4 SV=1
11	AFDB:Q9LZI4	0.327	0.532	5.099E-2	106	0.101	0.170	Q9LZI4.pdb.gz	Q9LZI4_ARATH At3g62810 OS=Arabidopsis thaliana OX=3702 GN=F26K9_240 PE=1 SV=1
12	AFDB:A0A024R3C2	0.288	0.403	6.160E-2	122	0.134	0.197	A0A024R3C2.pdb.gz
13	AFDB:Q9P7Y2	0.205	0.307	6.160E-2	115	0.123	0.191	Q9P7Y2.pdb.gz	SDHF3_SCHPO Succinate dehydrogenase assembly factor 3, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBP23A10.03c PE=3 SV=1
14	AFDB:Q04401	0.278	0.366	8.441E-2	133	0.106	0.143	Q04401.pdb.gz	SDHF3_YEAST Succinate dehydrogenase assembly factor 3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SDH7 PE=1 SV=1
15	PDB:6sgaFb	0.332	0.441	1.979E-1	129	0.128	0.178	6sgaFb.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
16	PDB:5xtbH	0.261	0.377	8.976E-1	112	0.089	0.143	5xtbH.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
17	PDB:7b93V	0.250	0.351	2.619	115	0.084	0.130	7b93V.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
18	PDB:4uelA	0.107	0.073	2.790	302	0.084	0.050	4uelA.pdb.gz
19	PDB:7pntL	0.157	0.159	2.790	176	0.084	0.085	7pntL.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
20	PDB:7qsmW	0.309	0.466	3.164	116	0.073	0.112	7qsmW.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y6M9	1.37e-131	367	179	1.000	1.000	NDUB9_HUMAN NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 OS=Homo sapiens OX=9606 GN=NDUFB9 PE=1 SV=3
2	Q02369	2.03e-121	342	179	0.911	0.911	NDUB9_BOVIN NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 OS=Bos taurus OX=9913 GN=NDUFB9 PE=1 SV=2
3	E9PH64	3.02e-119	336	168	0.939	1.000	E9PH64_HUMAN NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 OS=Homo sapiens OX=9606 GN=NDUFB9 PE=1 SV=1
4	Q9CQJ8	8.44e-114	322	179	0.866	0.866	NDUB9_MOUSE NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 OS=Mus musculus OX=10090 GN=Ndufb9 PE=1 SV=3
5	E7EWZ0	9.46e-100	287	178	0.765	0.770	E7EWZ0_HUMAN NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 OS=Homo sapiens OX=9606 GN=NDUFB9 PE=1 SV=1
6	A0A3B3IT57	2.65e-99	284	138	0.765	0.993	A0A3B3IT57_HUMAN NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 OS=Homo sapiens OX=9606 GN=NDUFB9 PE=1 SV=1
7	Q945M1	2.22e-09	54.7	117	0.156	0.239	NDUB9_ARATH NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 OS=Arabidopsis thaliana OX=3702 GN=CIB22 PE=1 SV=1
8	Q381K5	3.81e-04	42.0	304	0.117	0.069	Q381K5_TRYB2 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.7460 PE=3 SV=1
9	P53687	0.24	33.9	447	0.151	0.060	HST3_YEAST NAD-dependent histone deacetylase HST3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HST3 PE=1 SV=1
10	Q7ZW36	1.3	32.0	638	0.156	0.044	Q7ZW36_DANRE Potassium voltage-gated channel subfamily D member 3 precursor OS=Danio rerio OX=7955 GN=wu:fi06g01 PE=2 SV=1
11	Q8MR70	1.5	31.6	1529	0.134	0.016	Q8MR70_DROME oleoyl-[acyl-carrier-protein] hydrolase (Fragment) OS=Drosophila melanogaster OX=7227 GN=FASN2 PE=2 SV=1
12	M9PB21	1.7	31.6	2410	0.134	0.010	M9PB21_DROME Fatty acid synthase 2, isoform B OS=Drosophila melanogaster OX=7227 GN=FASN2 PE=1 SV=1
13	A0A286Y962	1.8	31.6	650	0.156	0.043	A0A286Y962_DANRE Potassium voltage-gated channel subfamily D member 3 isoform X1 OS=Danio rerio OX=7955 GN=wu:fi06g01 PE=4 SV=1
14	P08617	1.9	31.6	2227	0.106	0.009	POLG_HAVHM Genome polyprotein OS=Human hepatitis A virus genotype IB (isolate HM175) OX=12098 PE=1 SV=1
15	Q9VQL6	1.9	31.6	2409	0.134	0.010	Q9VQL6_DROME Fatty acid synthase 2, isoform A OS=Drosophila melanogaster OX=7227 GN=FASN2 PE=1 SV=1
16	Q80W93	2.1	31.6	5154	0.123	0.004	HYDIN_MOUSE Hydrocephalus-inducing protein OS=Mus musculus OX=10090 GN=Hydin PE=1 SV=2
17	O08710	2.5	31.2	2766	0.067	0.004	THYG_MOUSE Thyroglobulin OS=Mus musculus OX=10090 GN=Tg PE=1 SV=3
18	Q6P7F1	4.3	30.4	635	0.089	0.025	MPP4_MOUSE MAGUK p55 subfamily member 4 OS=Mus musculus OX=10090 GN=Mpp4 PE=1 SV=1
19	A2RU80	4.7	30.0	630	0.101	0.029	A2RU80_HUMAN MPP4 protein OS=Homo sapiens OX=9606 GN=MPP4 PE=1 SV=1
20	E7EUL8	4.9	30.0	630	0.101	0.029	E7EUL8_HUMAN MAGUK p55 scaffold protein 4 OS=Homo sapiens OX=9606 GN=MPP4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05347 Complex1_LYR	8.5e-08	43.5	Complex 1 protein (LYR family)
2	PF13233 Complex1_LYR_2	0.47	22.5	Complex1_LYR-like
3	PF06812 ImpA_N	1e+02	14.4	ImpA, N-terminal, type VI secretion system

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000276689

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000184266	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4
2	9606.ENSP00000215565	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7
3	9606.ENSP00000233627	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
4	9606.ENSP00000252102	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
5	9606.ENSP00000252711	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial
6	9606.ENSP00000259037	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial
7	9606.ENSP00000263774	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
8	9606.ENSP00000266544	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
9	9606.ENSP00000268668	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10
10	9606.ENSP00000274137	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial
11	9606.ENSP00000276062	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial
12	9606.ENSP00000281031	0.999	NADH dehydrogenase [ubiquinone] 1 subunit C2
13	9606.ENSP00000296684	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial
14	9606.ENSP00000299166	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial
15	9606.ENSP00000301457	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7
16	9606.ENSP00000315774	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial
17	9606.ENSP00000322450	0.999	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
18	9606.ENSP00000327268	0.999	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial
19	9606.ENSP00000330737	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12
20	9606.ENSP00000356972	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008137	1.000	NADH dehydrogenase (ubiquinone) activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006119	0.997	oxidative phosphorylation
GO:0019646	0.992	aerobic electron transport chain
GO:0042775	0.992	mitochondrial ATP synthesis coupled electron transport
GO:0032981	0.991	mitochondrial respiratory chain complex I assembly
GO:0007605	0.987	sensory perception of sound
GO:0006120	0.978	mitochondrial electron transport, NADH to ubiquinone

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005743	0.999	mitochondrial inner membrane
GO:0098798	0.995	mitochondrial protein-containing complex
GO:1902494	0.992	catalytic complex
GO:0098796	0.991	membrane protein complex
GO:0098800	0.977	inner mitochondrial membrane protein complex
GO:0005746	0.960	mitochondrial respirasome
GO:0098803	0.957	respiratory chain complex
GO:0005747	0.939	mitochondrial respiratory chain complex I

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29091	1.000	a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+)
EC:7.1.1.2	1.000	NADH:ubiquinone reductase (H(+)-translocating).

[back to server]