StarFunc result for job id Q9Y6N1

User Input

>input (276 residues)
MGGLWRPGWRCVPFCGWRWIHPGSPTRAAERVEPFLRPEWSGTGGAERGLRWLGTWKRCS
LRARHPALQPPRRPKSSNPFTRAQEEERRRQNKTTLTYVAAVAVGMLGASYAAVPLYRLY
CQTTGLGGSAVAGHASDKIENMVPVKDRIIKISFNADVHASLQWNFRPQQTEIYVVPGET
ALAFYRAKNPTDKPVIGISTYNIVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYID
PEFAEDPRMIKVDLITLSYTFFEAKEGHKLPVPGYN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y6N1	1.000	1.000	4.941E-51	276	1.000	1.000	Q9Y6N1.pdb.gz	COX11_HUMAN Cytochrome c oxidase assembly protein COX11, mitochondrial OS=Homo sapiens OX=9606 GN=COX11 PE=1 SV=3
2	AFDB:Q6P8I6	0.729	0.732	5.317E-45	275	0.837	0.840	Q6P8I6.pdb.gz	COX11_MOUSE Cytochrome c oxidase assembly protein COX11, mitochondrial OS=Mus musculus OX=10090 GN=Cox11 PE=1 SV=1
3	AFDB:Q8GWR0	0.600	0.578	7.148E-28	287	0.399	0.383	Q8GWR0.pdb.gz	COX11_ARATH Cytochrome c oxidase assembly protein COX11, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=COX11 PE=2 SV=1
4	AFDB:Q59PA0	0.471	0.476	7.325E-26	273	0.373	0.377	Q59PA0.pdb.gz	Q59PA0_CANAL Cox11p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=COX11 PE=3 SV=1
5	AFDB:Q9UTM2	0.472	0.202	1.316E-25	753	0.384	0.141	Q9UTM2.pdb.gz	CO111_SCHPO Rsm22-cox11 tandem protein 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cox1101 PE=1 SV=2
6	AFDB:P19516	0.462	0.432	2.103E-25	300	0.413	0.380	P19516.pdb.gz	COX11_YEAST Cytochrome c oxidase assembly protein COX11, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COX11 PE=1 SV=2
7	AFDB:Q38BT4	0.577	0.676	4.617E-23	232	0.297	0.353	Q38BT4.pdb.gz	Q38BT4_TRYB2 Cytochrome C oxidase assembly protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4380 PE=4 SV=1
8	PDB:4b0mM	0.167	0.209	3.035E-3	212	0.054	0.071	4b0mM.pdb.gz
9	AFDB:P97629	0.126	0.049	6.253E-3	1025	0.112	0.030	P97629.pdb.gz	LCAP_RAT Leucyl-cystinyl aminopeptidase OS=Rattus norvegicus OX=10116 GN=Lnpep PE=1 SV=1
10	PDB:7b0xC	0.154	0.195	8.219E-3	211	0.040	0.052	7b0xC.pdb.gz
11	PDB:7sqcO0	0.183	0.050	8.715E-3	1140	0.025	0.006	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
12	PDB:5ghuA	0.168	0.220	1.660E-2	201	0.047	0.065	5ghuA.pdb.gz
13	PDB:4rtdA	0.193	0.051	1.980E-2	1122	0.051	0.012	4rtdA.pdb.gz
14	AFDB:M9PCN5	0.107	0.038	2.019E-2	929	0.123	0.037	M9PCN5.pdb.gz	M9PCN5_DROME PH-sensitive chloride channel 1, isoform O OS=Drosophila melanogaster OX=7227 GN=pHCl-1 PE=4 SV=1
15	PDB:3dpaA	0.163	0.198	2.502E-2	218	0.051	0.064	3dpaA.pdb.gz
16	AFDB:P41047	0.160	0.159	2.552E-2	279	0.123	0.122	P41047.pdb.gz	TNFL6_MOUSE Tumor necrosis factor ligand superfamily member 6 OS=Mus musculus OX=10090 GN=Faslg PE=1 SV=1
17	PDB:2mspA	0.200	0.385	2.653E-2	124	0.040	0.089	2mspA.pdb.gz
18	PDB:4lk4A	0.135	0.118	2.814E-2	326	0.040	0.034	4lk4A.pdb.gz
19	PDB:6xt9A	0.200	0.105	3.999E-2	567	0.087	0.042	6xt9A.pdb.gz
20	PDB:5a42A	0.198	0.039	4.241E-2	1597	0.047	0.008	5a42A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y6N1	0.0	575	276	1.000	1.000	COX11_HUMAN Cytochrome c oxidase assembly protein COX11, mitochondrial OS=Homo sapiens OX=9606 GN=COX11 PE=1 SV=3
2	Q6P8I6	4.62e-170	473	275	0.841	0.844	COX11_MOUSE Cytochrome c oxidase assembly protein COX11, mitochondrial OS=Mus musculus OX=10090 GN=Cox11 PE=1 SV=1
3	P19516	7.21e-67	212	300	0.409	0.377	COX11_YEAST Cytochrome c oxidase assembly protein COX11, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COX11 PE=1 SV=2
4	Q8GWR0	3.02e-63	202	287	0.344	0.331	COX11_ARATH Cytochrome c oxidase assembly protein COX11, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=COX11 PE=2 SV=1
5	Q9UTM2	5.00e-63	213	753	0.355	0.130	CO111_SCHPO Rsm22-cox11 tandem protein 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cox1101 PE=1 SV=2
6	Q59PA0	7.12e-59	190	273	0.326	0.330	Q59PA0_CANAL Cox11p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=COX11 PE=3 SV=1
7	Q38BT4	3.04e-46	156	232	0.293	0.349	Q38BT4_TRYB2 Cytochrome C oxidase assembly protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4380 PE=4 SV=1
8	Q12469	0.56	34.3	655	0.098	0.041	SKM1_YEAST Serine/threonine-protein kinase SKM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SKM1 PE=1 SV=1
9	P36021	2.1	32.3	539	0.065	0.033	MOT8_HUMAN Monocarboxylate transporter 8 OS=Homo sapiens OX=9606 GN=SLC16A2 PE=1 SV=2
10	Q8K1P8	3.7	31.6	545	0.065	0.033	MOT8_RAT Monocarboxylate transporter 8 OS=Rattus norvegicus OX=10116 GN=SLC16A2 PE=1 SV=2
11	O70324	3.8	31.6	545	0.065	0.033	MOT8_MOUSE Monocarboxylate transporter 8 OS=Mus musculus OX=10090 GN=Slc16a2 PE=1 SV=2
12	Q1XG76	7.0	30.0	207	0.101	0.135	Q1XG76_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=si:dkeyp-74c5.3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04442 CtaG_Cox11	1.6e-55	198.6	Cytochrome c oxidase assembly protein CtaG/Cox11
2	PF10399 UCR_Fe-S_N	1.1e+02	13.6	Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000299335

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261070	0.985	Cytochrome c oxidase copper chaperone
2	9606.ENSP00000255390	0.970	Protein SCO1 homolog, mitochondrial
3	9606.ENSP00000307786	0.939	Cytochrome c
4	9606.ENSP00000342015	0.933	Cytochrome c oxidase assembly protein COX19
5	9606.ENSP00000016171	0.924	Cytochrome c oxidase assembly protein COX15 homolog
6	9606.ENSP00000444433	0.917	Protein SCO2 homolog, mitochondrial
7	9606.ENSP00000361042	0.892	Surfeit locus protein 1
8	9606.ENSP00000261643	0.885	Protoheme IX farnesyltransferase, mitochondrial
9	9606.ENSP00000430598	0.863	Copper transport protein ATOX1
10	9606.ENSP00000354876	0.853	Cytochrome c oxidase subunit 2
11	9606.ENSP00000354499	0.839	Cytochrome c oxidase subunit 1
12	9606.ENSP00000306425	0.829	Mitochondrial coiled-coil-helix-coiled-coil-helix domain containing proteins
13	9606.ENSP00000295767	0.826	Mitochondrial intermembrane space import and assembly protein 40
14	9606.ENSP00000365530	0.813	Syntaxin-binding protein 4
15	9606.ENSP00000330730	0.812	Cytochrome c oxidase assembly factor 5
16	9606.ENSP00000425261	0.797	Mitochondrial inner membrane protein COX18
17	9606.ENSP00000460823	0.759	TOM1-like protein 1
18	9606.ENSP00000354632	0.753	ATP synthase subunit a
19	9606.ENSP00000416429	0.739	Ribosomal protein L32
20	9606.ENSP00000354982	0.738	Cytochrome c oxidase subunit 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016491	0.996	oxidoreductase activity
GO:0009055	0.993	electron transfer activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.876	biological regulation
GO:0050794	0.869	regulation of cellular process
GO:0031323	0.835	regulation of cellular metabolic process
GO:0009987	0.814	cellular process
GO:0080090	0.798	regulation of primary metabolic process
GO:0006109	0.781	regulation of carbohydrate metabolic process
GO:0008152	0.744	metabolic process
GO:0050790	0.663	regulation of catalytic activity
GO:0051174	0.642	regulation of phosphorus metabolic process
GO:0010563	0.629	negative regulation of phosphorus metabolic process
GO:0051338	0.588	regulation of transferase activity
GO:0019220	0.587	regulation of phosphate metabolic process
GO:0042325	0.579	regulation of phosphorylation
GO:0045936	0.577	negative regulation of phosphate metabolic process
GO:0042326	0.570	negative regulation of phosphorylation
GO:0044237	0.568	cellular metabolic process
GO:0062012	0.567	regulation of small molecule metabolic process
GO:0045912	0.565	negative regulation of carbohydrate metabolic process
GO:0043086	0.545	negative regulation of catalytic activity
GO:0051348	0.437	negative regulation of transferase activity
GO:0010675	0.437	regulation of cellular carbohydrate metabolic process
GO:0033673	0.408	negative regulation of kinase activity
GO:0071840	0.372	cellular component organization or biogenesis
GO:0016043	0.343	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0016020	0.992	membrane
GO:0032991	0.949	protein-containing complex
GO:0031090	0.935	organelle membrane
GO:0005743	0.916	mitochondrial inner membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.996	Oxidoreductases.

[back to server]