StarFunc result for job id Q9Y6N5

User Input

>input (450 residues)
MVPLVAVVSGPRAQLFACLLRLGTQQVGPLQLHTGASHAARNHYEVLVLGGGSGGITMAA
RMKRKVGAENVAIVEPSERHFYQPIWTLVGAGAKQLSSSGRPTASVIPSGVEWIKARVTE
LNPDKNCIHTDDDEKISYRYLIIALGIQLDYEKIKGLPEGFAHPKIGSNYSVKTVEKTWK
ALQDFKEGNAIFTFPNTPVKCAGAPQKIMYLSEAYFRKTGKRSKANIIFNTSLGAIFGVK
KYADALQEIIQERNLTVNYKKNLIEVRADKQEAVFENLDKPGETQVISYEMLHVTPPMSP
PDVLKTSPVADAAGWVDVDKETLQHRRYPNVFGIGDCTNLPTSKTAAAVAAQSGILDRTI
SVIMKNQTPTKKYDGYTSCPLVTGYNRVILAEFDYKAEPLETFPFDQSKERLSMYLMKAD
LMPFLYWNMMLRGYWGGPAFLRKLFHLGMS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y6N5	1.000	1.000	1.738E-92	450	1.000	1.000	Q9Y6N5.pdb.gz	SQOR_HUMAN Sulfide:quinone oxidoreductase, mitochondrial OS=Homo sapiens OX=9606 GN=SQOR PE=1 SV=1
2	AFDB:B0BMT9	0.911	0.911	5.772E-87	450	0.898	0.898	B0BMT9.pdb.gz	B0BMT9_RAT Sulfide quinone oxidoreductase OS=Rattus norvegicus OX=10116 GN=Sqor PE=4 SV=1
3	PDB:6mo6B	0.908	0.987	2.061E-78	414	0.909	0.988	6mo6B.pdb.gz	X-Ray Structure of Human Sulfide:Quinone Oxidoreductase: Insights into the Mechanism of Mitochondrial Hydrogen Sulfide Oxidation.
4	AFDB:B0LD08	0.898	0.883	9.440E-63	458	0.511	0.502	B0LD08.pdb.gz	B0LD08_AREMA Sulfide:quinone oxidoreductase OS=Arenicola marina OX=6344 GN=SQR PE=2 SV=1
5	AFDB:O94284	0.866	0.850	9.356E-48	459	0.382	0.375	O94284.pdb.gz	HMT2_SCHPO Sulfide:quinone oxidoreductase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hmt2 PE=3 SV=1
6	PDB:3hyvA	0.735	0.769	4.050E-25	429	0.191	0.200	3hyvA.pdb.gz	The structure of Aquifex aeolicus sulfide:quinone oxidoreductase, a basis to understand sulfide detoxification and respiration
7	AFDB:O67931	0.758	0.790	4.372E-25	430	0.198	0.207	O67931.pdb.gz	SQRD_AQUAE Sulfide-quinone reductase OS=Aquifex aeolicus (strain VF5) OX=224324 GN=sqr PE=1 SV=1
8	AFDB:Q38BX7	0.764	0.607	6.124E-24	575	0.182	0.143	Q38BX7.pdb.gz	Q38BX7_TRYB2 FAD/NAD(P)-binding domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4980 PE=4 SV=1
9	AFDB:Q2FID4	0.650	0.718	3.529E-21	402	0.169	0.189	Q2FID4.pdb.gz	NDH_STAA3 Type II NADH:quinone oxidoreductase OS=Staphylococcus aureus (strain USA300) OX=367830 GN=SAUSA300_0844 PE=3 SV=1
10	AFDB:Q8GXR9	0.662	0.583	6.829E-20	519	0.171	0.148	Q8GXR9.pdb.gz	NDC1_ARATH Alternative NAD(P)H-ubiquinone oxidoreductase C1, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=NDC1 PE=1 SV=2
11	AFDB:Q72AL8	0.616	0.736	8.940E-20	367	0.142	0.174	Q72AL8.pdb.gz	Q72AL8_DESVH Pyridine nucleotide-disulfide oxidoreductase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_1974 PE=1 SV=1
12	AFDB:P95160	0.598	0.584	2.265E-18	463	0.184	0.179	P95160.pdb.gz	NDH_MYCTU Type II NADH:quinone oxidoreductase Ndh OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ndh PE=1 SV=1
13	PDB:5yjyB	0.623	0.605	6.863E-18	465	0.187	0.181	5yjyB.pdb.gz	Ubiquinone binding site of yeast NADH dehydrogenase revealed by structures binding novel competitive- and mixed-type inhibitors
14	PDB:4g6hA	0.609	0.585	5.609E-17	472	0.187	0.178	4g6hA.pdb.gz	Structural insight into the type-II mitochondrial NADH dehydrogenases.
15	PDB:5jwaA	0.632	0.581	6.247E-17	495	0.147	0.133	5jwaA.pdb.gz	Target Elucidation by Cocrystal Structures of NADH-Ubiquinone Oxidoreductase of Plasmodium falciparum (PfNDH2) with Small Molecule To Eliminate Drug-Resistant Malaria
16	PDB:2v3aA	0.553	0.640	3.747E-15	381	0.107	0.126	2v3aA.pdb.gz	Crystal Structure of the Electron Transfer Complex Rubredoxin - Rubredoxin Reductase from Pseudomonas Aeruginosa.
17	PDB:5jciA	0.549	0.569	2.606E-14	432	0.113	0.118	5jciA.pdb.gz	Structure and catalytic mechanism of monodehydroascorbate reductase, MDHAR, from Oryza sativa L. japonica
18	PDB:1q1wA	0.579	0.612	4.009E-14	422	0.107	0.114	1q1wA.pdb.gz	Crystal structure of putidaredoxin reductase from Pseudomonas putida, the final structural component of the cytochrome P450cam monooxygenase.
19	PDB:6hg8B	0.532	0.501	8.076E-14	482	0.127	0.118	6hg8B.pdb.gz	Crystal structure of the R460G disease-causing mutant of the human dihydrolipoamide dehydrogenase.
20	PDB:7kmyA	0.498	0.484	1.002E-13	465	0.127	0.123	7kmyA.pdb.gz	Whole cell active inhibitors of mycobacterial lipoamide dehydrogenase afford selectivity over the human enzyme through tight binding interactions

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B0BMT9	0.0	842	450	0.898	0.898	B0BMT9_RAT Sulfide quinone oxidoreductase OS=Rattus norvegicus OX=10116 GN=Sqor PE=4 SV=1
2	Q9R112	0.0	813	450	0.869	0.869	SQOR_MOUSE Sulfide:quinone oxidoreductase, mitochondrial OS=Mus musculus OX=10090 GN=Sqor PE=1 SV=3
3	Q9Y6N5	0.0	940	450	1.000	1.000	SQOR_HUMAN Sulfide:quinone oxidoreductase, mitochondrial OS=Homo sapiens OX=9606 GN=SQOR PE=1 SV=1
4	B0LD08	6.04e-166	477	458	0.489	0.480	B0LD08_AREMA Sulfide:quinone oxidoreductase OS=Arenicola marina OX=6344 GN=SQR PE=2 SV=1
5	O94284	2.46e-101	311	459	0.382	0.375	HMT2_SCHPO Sulfide:quinone oxidoreductase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hmt2 PE=3 SV=1
6	O67931	5.26e-12	69.7	430	0.142	0.149	SQRD_AQUAE Sulfide-quinone reductase OS=Aquifex aeolicus (strain VF5) OX=224324 GN=sqr PE=1 SV=1
7	Q8GXR9	2.75e-08	58.2	519	0.198	0.171	NDC1_ARATH Alternative NAD(P)H-ubiquinone oxidoreductase C1, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=NDC1 PE=1 SV=2
8	Q38BX7	5.81e-08	57.4	575	0.107	0.083	Q38BX7_TRYB2 FAD/NAD(P)-binding domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4980 PE=4 SV=1
9	Q5AEC9	5.50e-05	47.8	574	0.182	0.143	Q5AEC9_CANAL NADH-ubiquinone reductase (H(+)-translocating) OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=NDE1 PE=3 SV=1
10	Q9C574	7.69e-04	43.9	365	0.169	0.208	Q9C574_ARATH FAD/NAD(P)-binding oxidoreductase family protein OS=Arabidopsis thaliana OX=3702 GN=At5g22140 PE=1 SV=1
11	Q72AL8	0.001	43.1	367	0.158	0.193	Q72AL8_DESVH Pyridine nucleotide-disulfide oxidoreductase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_1974 PE=1 SV=1
12	Q07500	0.004	42.0	545	0.064	0.053	NDH2_YEAST External NADH-ubiquinone oxidoreductase 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NDE2 PE=1 SV=1
13	O14121	0.006	41.6	551	0.167	0.136	NDH1_SCHPO Probable NADH-ubiquinone oxidoreductase C3A11.07, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC3A11.07 PE=3 SV=1
14	Q2FID4	0.012	40.0	402	0.067	0.075	NDH_STAA3 Type II NADH:quinone oxidoreductase OS=Staphylococcus aureus (strain USA300) OX=367830 GN=SAUSA300_0844 PE=3 SV=1
15	P32340	0.032	38.9	513	0.073	0.064	NDI1_YEAST Rotenone-insensitive NADH-ubiquinone oxidoreductase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NDI1 PE=1 SV=1
16	Q8I302	0.12	37.4	533	0.158	0.133	Q8I302_PLAF7 Type II NADH:ubiquinone oxidoreductase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0915000 PE=1 SV=1
17	P52923	0.13	37.0	378	0.158	0.188	AIF1_YEAST Apoptosis-inducing factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AIF1 PE=1 SV=1
18	P40215	0.16	37.0	560	0.053	0.043	NDH1_YEAST External NADH-ubiquinone oxidoreductase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NDE1 PE=1 SV=1
19	P95160	0.38	35.4	463	0.058	0.056	NDH_MYCTU Type II NADH:quinone oxidoreductase Ndh OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ndh PE=1 SV=1
20	P95200	0.44	35.4	470	0.071	0.068	NDHA_MYCTU Type II NADH:quinone oxidoreductase NdhA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ndhA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12831 FAD_oxidored	4.4e+02	11.5	FAD dependent oxidoreductase
2	PF05834 Lycopene_cycl	5.6	17.5	Lycopene cyclase protein
3	PF07992 Pyr_redox_2	3.7e-13	61.0	Pyridine nucleotide-disulphide oxidoreductase
4	PF13738 Pyr_redox_3	9.7e+02	10.4	Pyridine nucleotide-disulphide oxidoreductase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000260324

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000292147	0.988	Persulfide dioxygenase ETHE1, mitochondrial
2	9606.ENSP00000385828	0.975	Thiosulfate sulfurtransferase
3	9606.ENSP00000397261	0.906	Selenium-binding protein 1
4	9606.ENSP00000377668	0.813	Sulfite oxidase, mitochondrial
5	9606.ENSP00000359976	0.720	Cystathionine gamma-lyase
6	9606.ENSP00000399805	0.712	Quinone oxidoreductase
7	9606.ENSP00000380402	0.705	3-mercaptopyruvate sulfurtransferase
8	9606.ENSP00000264932	0.648	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
9	9606.ENSP00000406157	0.643	Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2
10	9606.ENSP00000388293	0.631	Thiosulfate:glutathione sulfurtransferase
11	9606.ENSP00000381234	0.629	annotation not available
12	9606.ENSP00000381231	0.628	Hydro-lyase catalyzing the first step of the transsulfuration pathway, where the hydroxyl group of L-serine is displaced by L- homocysteine in a beta-replacement reaction to form L-cystathionine, the precursor of L-cysteine. This catabolic route allows the elimination of L-methionine and the toxic metabolite L-homocysteine. Also involved in the production of hydrogen sulfide, a gasotransmitter with signaling and cytoprotective effects on neurons.
13	9606.ENSP00000364649	0.626	Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
14	9606.ENSP00000308082	0.615	Olfactory receptor 10P1
15	9606.ENSP00000364699	0.609	Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial
16	9606.ENSP00000262507	0.604	Ubiquinone biosynthesis protein COQ9, mitochondrial
17	9606.ENSP00000354554	0.594	Cytochrome b
18	9606.ENSP00000265174	0.591	Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1
19	9606.ENSP00000426638	0.582	Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial
20	9606.ENSP00000389813	0.578	Acyl-CoA dehydrogenase family member 10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0070224	0.999	sulfide:quinone oxidoreductase activity
GO:0005488	0.951	binding
GO:0005515	0.906	protein binding
GO:1901363	0.625	heterocyclic compound binding
GO:0097159	0.621	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006790	0.996	sulfur compound metabolic process
GO:0071704	0.660	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005743	1.000	mitochondrial inner membrane
GO:0070013	0.671	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:30239	0.999	n a quinone + n H(+) + n hydrogen sulfide = n a quinol + n sulfur

[back to server]