StarFunc result for job id Q9Y6N6

User Input

>input (1575 residues)
MAAAALLLGLALLAPRAAGAGMGACYDGAGRPQRCLPVFENAAFGRLAQASHTCGSPPED
FCPHVGAAGAGAHCQRCDAADPQRHHNASYLTDFHSQDESTWWQSPSMAFGVQYPTSVNI
TLRLGKAYEITYVRLKFHTSRPESFAIYKRSRADGPWEPYQFYSASCQKTYGRPEGQYLR
PGEDERVAFCTSEFSDISPLSGGNVAFSTLEGRPSAYNFEESPGLQEWVTSTELLISLDR
LNTFGDDIFKDPKVLQSYYYAVSDFSVGGRCKCNGHASECGPDVAGQLACRCQHNTTGTD
CERCLPFFQDRPWARGTAEAAHECLPCNCSGRSEECTFDRELFRSTGHGGRCHHCRDHTA
GPHCERCQENFYHWDPRMPCQPCDCQSAGSLHLQCDDTGTCACKPTVTGWKCDRCLPGFH
SLSEGGCRPCTCNPAGSLDTCDPRSGRCPCKENVEGNLCDRCRPGTFNLQPHNPAGCSSC
FCYGHSKVCASTAQFQVHHILSDFHQGAEGWWARSVGGSEHPPQWSPNGVLLSPEDEEEL
TAPEKFLGDQRFSYGQPLILTFRVPPGDSPLPVQLRLEGTGLALSLRHSSLSGPQDAGHP
REVELRFHLQETSEDVAPPLPPFHFQRLLANLTSLRLRVSPGPSPAGPVFLTEVRLTSAR
PGLSPPASWVEICSCPTGYTGQFCESCAPGYKREMPQGGPYASCVPCTCNQHGTCDPNTG
ICVCSHHTEGPSCERCLPGFYGNPFAGQADDCQPCPCPGQSACTTIPESREVVCTHCPPG
QRGRRCEVCDDGFFGDPLGLFGHPQPCHQCQCSGNVDPNAVGNCDPLSGHCLRCLHNTTG
DHCEHCQEGFYGSALAPRPADKCMPCSCHPQGSVSEQMPCDPVTGQCSCLPHVTARDCSR
CYPGFFDLQPGRGCRSCKCHPLGSQEDQCHPKTGQCTCRPGVTGQACDRCQLGFFGFSIK
GCRACRCSPLGAASAQCHENGTCVCRPGFEGYKCDRCHDNFFLTADGTHCQQCPSCYALV
KEEAAKLKARLTLTEGWLQGSDCGSPWGPLDILLGEAPRGDVYQGHHLLPGAREAFLEQM
MSLEGAVKAAREQLQRLNKGARCAQAGSQKTCTQLADLEAVLESSEEEILHAAAILASLE
IPQEGPSQPTKWSHLATEARALARSHRDTATKIAATAWRALLASNTSYALLWNLLEGRVA
LETQRDLEDRYQEVQAAQKALRTAVAEVLPEAESVLATVQQVGADTAPYLALLASPGALP
QKSRAEDLGLKAKALEKTVASWQHMATEAARTLQTAAQATLRQTEPLTKLHQEARAALTQ
ASSSVQAATVTVMGARTLLADLEGMKLQFPRPKDQAALQRKADSVSDRLLADTRKKTKQA
ERMLGNAAPLSSSAKKKGREAEVLAKDSAKLAKALLRERKQAHRRASRLTSQTQATLQQA
SQQVLASEARRQELEEAERVGAGLSEMEQQIRESRISLEKDIETLSELLARLGSLDTHQA
PAQALNETQWALERLRLQLGSPGSLQRKLSLLEQESQQQELQIQGFESDLAEIRADKQNL
EAILHSLPENCASWQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1QPJ1	0.217	0.209	0.000	1643	0.437	0.419	F1QPJ1.pdb.gz	F1QPJ1_DANRE Laminin subunit gamma-3 OS=Danio rerio OX=7955 GN=lamc3 PE=4 SV=1
2	AFDB:P11047	0.263	0.258	0.000	1609	0.436	0.427	P11047.pdb.gz	LAMC1_HUMAN Laminin subunit gamma-1 OS=Homo sapiens OX=9606 GN=LAMC1 PE=1 SV=3
3	AFDB:P15215	0.222	0.214	0.000	1639	0.363	0.349	P15215.pdb.gz	LAMC1_DROME Laminin subunit gamma-1 OS=Drosophila melanogaster OX=7227 GN=LanB2 PE=2 SV=2
4	AFDB:Q18823	0.235	0.227	0.000	1633	0.353	0.340	Q18823.pdb.gz	LAM2_CAEEL Laminin-like protein lam-2 OS=Caenorhabditis elegans OX=6239 GN=lam-2 PE=1 SV=3
5	AFDB:Q1LVF0	0.236	0.233	0.000	1593	0.425	0.421	Q1LVF0.pdb.gz	LAMC1_DANRE Laminin subunit gamma-1 OS=Danio rerio OX=7955 GN=lamc1 PE=2 SV=2
6	AFDB:Q9R0B6	0.490	0.489	0.000	1581	0.747	0.744	Q9R0B6.pdb.gz	LAMC3_MOUSE Laminin subunit gamma-3 OS=Mus musculus OX=10090 GN=Lamc3 PE=1 SV=2
7	AFDB:Q9Y6N6	1.000	1.000	0.000	1575	1.000	1.000	Q9Y6N6.pdb.gz	LAMC3_HUMAN Laminin subunit gamma-3 OS=Homo sapiens OX=9606 GN=LAMC3 PE=1 SV=3
8	AFDB:P55268	0.233	0.206	6.650E-82	1798	0.285	0.250	P55268.pdb.gz	LAMB2_HUMAN Laminin subunit beta-2 OS=Homo sapiens OX=9606 GN=LAMB2 PE=1 SV=2
9	AFDB:A0A0R4IDN1	0.245	0.218	1.181E-81	1785	0.277	0.244	A0A0R4IDN1.pdb.gz
10	AFDB:P11046	0.232	0.206	2.510E-77	1788	0.266	0.234	P11046.pdb.gz	LAMB1_DROME Laminin subunit beta-1 OS=Drosophila melanogaster OX=7227 GN=LanB1 PE=1 SV=4
11	PDB:7ufgB	0.073	0.093	2.658E-3	1182	0.053	0.070	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
12	PDB:1k12A	0.070	0.570	3.108E-3	158	0.017	0.165	1k12A.pdb.gz	A novel fucose recognition fold involved in innate immunity.
13	PDB:1o59A	0.074	0.327	2.780E-2	318	0.014	0.069	1o59A.pdb.gz
14	PDB:6mdsA	0.072	0.141	2.929E-2	787	0.013	0.027	6mdsA.pdb.gz	Molecular Basis of Broad SpectrumN-Glycan Specificity and Processing of Therapeutic IgG Monoclonal Antibodies by Endoglycosidase S2.
15	PDB:6u3tB	0.039	0.131	3.802E-2	253	0.013	0.079	6u3tB.pdb.gz	Structure-based discovery of a small-molecule inhibitor of methicillin-resistantStaphylococcus aureusvirulence.
16	PDB:7ufgA	0.062	0.083	4.006E-2	1151	0.052	0.071	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
17	PDB:2waaA	0.054	0.196	4.684E-2	335	0.015	0.069	2waaA.pdb.gz
18	PDB:6ve73	0.054	0.281	4.935E-2	187	0.018	0.150	6ve73.pdb.gz	The inner junction complex of the cilia is an interaction hub that involves tubulin post-translational modifications.
19	PDB:4bxsV	0.058	0.072	7.491E-2	1262	0.015	0.018	4bxsV.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
20	PDB:1xpwA	0.056	0.510	8.760E-2	143	0.012	0.133	1xpwA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1MAA7	0.0	1360	1607	0.441	0.432	F1MAA7_RAT Laminin subunit gamma 1 OS=Rattus norvegicus OX=10116 GN=Lamc1 PE=1 SV=1
2	F1MD77	0.0	1334	1608	0.441	0.432	F1MD77_BOVIN Laminin subunit gamma 1 OS=Bos taurus OX=9913 GN=LAMC1 PE=1 SV=2
3	F1QPJ1	0.0	1351	1643	0.443	0.424	F1QPJ1_DANRE Laminin subunit gamma-3 OS=Danio rerio OX=7955 GN=lamc3 PE=4 SV=1
4	P02468	0.0	1338	1607	0.443	0.434	LAMC1_MOUSE Laminin subunit gamma-1 OS=Mus musculus OX=10090 GN=Lamc1 PE=1 SV=2
5	P11047	0.0	1347	1609	0.440	0.431	LAMC1_HUMAN Laminin subunit gamma-1 OS=Homo sapiens OX=9606 GN=LAMC1 PE=1 SV=3
6	P15215	0.0	1011	1639	0.377	0.362	LAMC1_DROME Laminin subunit gamma-1 OS=Drosophila melanogaster OX=7227 GN=LanB2 PE=2 SV=2
7	Q18823	0.0	957	1633	0.366	0.353	LAM2_CAEEL Laminin-like protein lam-2 OS=Caenorhabditis elegans OX=6239 GN=lam-2 PE=1 SV=3
8	Q1LVF0	0.0	1267	1593	0.434	0.429	LAMC1_DANRE Laminin subunit gamma-1 OS=Danio rerio OX=7955 GN=lamc1 PE=2 SV=2
9	Q9R0B6	0.0	2366	1581	0.750	0.748	LAMC3_MOUSE Laminin subunit gamma-3 OS=Mus musculus OX=10090 GN=Lamc3 PE=1 SV=2
10	Q9Y6N6	0.0	3219	1575	1.000	1.000	LAMC3_HUMAN Laminin subunit gamma-3 OS=Homo sapiens OX=9606 GN=LAMC3 PE=1 SV=3
11	Q13753	1.46e-165	535	1193	0.177	0.233	LAMC2_HUMAN Laminin subunit gamma-2 OS=Homo sapiens OX=9606 GN=LAMC2 PE=1 SV=2
12	P19137	1.73e-163	553	3083	0.242	0.124	LAMA1_MOUSE Laminin subunit alpha-1 OS=Mus musculus OX=10090 GN=Lama1 PE=1 SV=2
13	F1MMT2	2.86e-161	539	1964	0.243	0.195	F1MMT2_BOVIN Laminin subunit alpha 2 OS=Bos taurus OX=9913 GN=LAMA2 PE=4 SV=3
14	Q61092	1.44e-160	521	1191	0.173	0.228	LAMC2_MOUSE Laminin subunit gamma-2 OS=Mus musculus OX=10090 GN=Lamc2 PE=1 SV=2
15	Q60675	2.09e-160	544	3118	0.243	0.123	LAMA2_MOUSE Laminin subunit alpha-2 OS=Mus musculus OX=10090 GN=Lama2 PE=1 SV=2
16	P25391	1.04e-159	541	3075	0.241	0.124	LAMA1_HUMAN Laminin subunit alpha-1 OS=Homo sapiens OX=9606 GN=LAMA1 PE=1 SV=2
17	F1LRH4	6.99e-159	516	1192	0.169	0.223	F1LRH4_RAT Laminin subunit gamma 2 OS=Rattus norvegicus OX=10116 GN=Lamc2 PE=4 SV=1
18	P24043	1.40e-158	538	3122	0.242	0.122	LAMA2_HUMAN Laminin subunit alpha-2 OS=Homo sapiens OX=9606 GN=LAMA2 PE=1 SV=4
19	A0A0G2JWX2	1.55e-157	535	3121	0.242	0.122	A0A0G2JWX2_RAT Laminin subunit alpha 2 OS=Rattus norvegicus OX=10116 GN=Lama2 PE=1 SV=1
20	F1M614	2.51e-157	535	3117	0.242	0.122	F1M614_RAT Laminin subunit alpha 2 OS=Rattus norvegicus OX=10116 GN=Lama2 PE=4 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07028 DUF1319	2.4e+02	13.3	Protein of unknown function (DUF1319)
2	PF00052 Laminin_B	1e-22	91.9	Laminin B (Domain IV)
3	PF00053 Laminin_EGF	6e-83	284.1	Laminin EGF domain
4	PF00055 Laminin_N	2.2e-72	254.9	Laminin N-terminal (Domain VI)
5	PF17495 OrfA	6.6e+02	11.9	Vpr-like OrfA

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354360

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000222399	0.988	Laminin subunit beta-1
2	9606.ENSP00000388325	0.987	Laminin subunit beta-2
3	9606.ENSP00000324532	0.986	Laminin subunit alpha-3
4	9606.ENSP00000252999	0.985	Laminin subunit alpha-5
5	9606.ENSP00000442600	0.958	Dystroglycan
6	9606.ENSP00000264187	0.942	Nidogen-1
7	9606.ENSP00000375778	0.941	Laminin subunit beta-3
8	9606.ENSP00000379350	0.930	Integrin beta-1
9	9606.ENSP00000400365	0.929	Laminin subunit alpha-2
10	9606.ENSP00000374309	0.928	Laminin subunit alpha-1
11	9606.ENSP00000230538	0.923	Laminin subunit alpha-4
12	9606.ENSP00000362680	0.921	Proto-oncogene tyrosine-protein kinase Src
13	9606.ENSP00000341189	0.919	Focal adhesion kinase 1
14	9606.ENSP00000368678	0.918	Agrin
15	9606.ENSP00000356515	0.916	Utrophin
16	9606.ENSP00000282588	0.915	Integrin alpha-1
17	9606.ENSP00000354923	0.915	Dystrophin
18	9606.ENSP00000347464	0.909	ARF GTPase-activating protein GIT2
19	9606.ENSP00000264144	0.906	Laminin subunit gamma-2
20	9606.ENSP00000383118	0.906	Cell division control protein 42 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005198	1.000	structural molecule activity
GO:0005515	0.995	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0048856	0.995	anatomical structure development
GO:0032501	0.994	multicellular organismal process
GO:0009653	0.966	anatomical structure morphogenesis
GO:0007275	0.966	multicellular organism development
GO:0030154	0.905	cell differentiation
GO:0048513	0.860	animal organ development
GO:0048731	0.835	system development
GO:0050789	0.813	regulation of biological process
GO:0050794	0.802	regulation of cellular process
GO:0071840	0.789	cellular component organization or biogenesis
GO:0016043	0.767	cellular component organization
GO:0048468	0.748	cell development
GO:0000902	0.745	cell morphogenesis
GO:0007399	0.726	nervous system development
GO:0022008	0.681	neurogenesis
GO:0003008	0.571	system process
GO:0050896	0.538	response to stimulus
GO:0007601	0.466	visual perception
GO:0048880	0.457	sensory system development
GO:0042063	0.414	gliogenesis
GO:0009888	0.410	tissue development
GO:0007417	0.393	central nervous system development
GO:0048518	0.375	positive regulation of biological process
GO:0010001	0.328	glial cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0031012	1.000	extracellular matrix
GO:0016020	0.993	membrane
GO:0032991	0.934	protein-containing complex
GO:0005886	0.888	plasma membrane
GO:0062023	0.864	collagen-containing extracellular matrix
GO:0005622	0.825	intracellular anatomical structure
GO:0043227	0.812	membrane-bounded organelle
GO:0043231	0.770	intracellular membrane-bounded organelle
GO:0005737	0.643	cytoplasm
GO:0005604	0.556	basement membrane
GO:0005615	0.305	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]