StarFunc result for job id Q9Y6N7

User Input

>input (1651 residues)
MKWKHVPFLVMISLLSLSPNHLFLAQLIPDPEDVERGNDHGTPIPTSDNDDNSLGYTGSR
LRQEDFPPRIVEHPSDLIVSKGEPATLNCKAEGRPTPTIEWYKGGERVETDKDDPRSHRM
LLPSGSLFFLRIVHGRKSRPDEGVYVCVARNYLGEAVSHNASLEVAILRDDFRQNPSDVM
VAVGEPAVMECQPPRGHPEPTISWKKDGSPLDDKDERITIRGGKLMITYTRKSDAGKYVC
VGTNMVGERESEVAELTVLERPSFVKRPSNLAVTVDDSAEFKCEARGDPVPTVRWRKDDG
ELPKSRYEIRDDHTLKIRKVTAGDMGSYTCVAENMVGKAEASATLTVQEPPHFVVKPRDQ
VVALGRTVTFQCEATGNPQPAIFWRREGSQNLLFSYQPPQSSSRFSVSQTGDLTITNVQR
SDVGYYICQTLNVAGSIITKAYLEVTDVIADRPPPVIRQGPVNQTVAVDGTFVLSCVATG
SPVPTILWRKDGVLVSTQDSRIKQLENGVLQIRYAKLGDTGRYTCIASTPSGEATWSAYI
EVQEFGVPVQPPRPTDPNLIPSAPSKPEVTDVSRNTVTLSWQPNLNSGATPTSYIIEAFS
HASGSSWQTVAENVKTETSAIKGLKPNAIYLFLVRAANAYGISDPSQISDPVKTQDVLPT
SQGVDHKQVQRELGNAVLHLHNPTVLSSSSIEVHWTVDQQSQYIQGYKILYRPSGANHGE
SDWLVFEVRTPAKNSVVIPDLRKGVNYEIKARPFFNEFQGADSEIKFAKTLEEAPSAPPQ
GVTVSKNDGNGTAILVSWQPPPEDTQNGMVQEYKVWCLGNETRYHINKTVDGSTFSVVIP
FLVPGIRYSVEVAASTGAGSGVKSEPQFIQLDAHGNPVSPEDQVSLAQQISDVVKQPAFI
AGIGAACWIILMVFSIWLYRHRKKRNGLTSTYAGIRKVPSFTFTPTVTYQRGGEAVSSGG
RPGLLNISEPAAQPWLADTWPNTGNNHNDCSISCCTAGNGNSDSNLTTYSRPADCIANYN
NQLDNKQTNLMLPESTVYGDVDLSNKINEMKTFNSPNLKDGRFVNPSGQPTPYATTQLIQ
SNLSNNMNNGSGDSGEKHWKPLGQQKQEVAPVQYNIVEQNKLNKDYRANDTVPPTIPYNQ
SYDQNTGGSYNSSDRGSSTSGSQGHKKGARTPKVPKQGGMNWADLLPPPPAHPPPHSNSE
EYNISVDESYDQEMPCPVPPARMYLQQDELEEEEDERGPTPPVRGAASSPAAVSYSHQST
ATLTPSPQEELQPMLQDCPEETGHMQHQPDRRRQPVSPPPPPRPISPPHTYGYISGPLVS
DMDTDAPEEEEDEADMEVAKMQTRRLLLRGLEQTPASSVGDLESSVTGSMINGWGSASEE
DNISSGRSSVSSSDGSFFTDADFAQAVAAAAEYAGLKVARRQMQDAAGRRHFHASQCPRP
TSPVSTDSNMSAAVMQKTRPAKKLKHQPGHLRRETYTDDLPPPPVPPPAIKSPTAQSKTQ
LEVRPVVVPKLPSMDARTDRSSDRKGSSYKGREVLDGRQVVDMRTNPGDPREAQEQQNDG
KGRGNKAAKRDLPPAKTHLIQEDILPYCRPTFPTSNNPRDPSSSSSMSSRGSGSRQREQA
NVGRRNIAEMQVLGGYERGEDNNEELEETES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2JZA1	0.329	0.357	0.000	1512	0.501	0.547	A0A0G2JZA1.pdb.gz	A0A0G2JZA1_RAT Roundabout guidance receptor 2 OS=Rattus norvegicus OX=10116 GN=Robo2 PE=4 SV=2
2	AFDB:A0A2R8QRK0	0.339	0.391	0.000	1420	0.432	0.502	A0A2R8QRK0.pdb.gz	A0A2R8QRK0_DANRE Roundabout homolog 3 isoform X3 OS=Danio rerio OX=7955 GN=cb503 PE=1 SV=1
3	AFDB:A4JYH1	0.336	0.600	0.000	862	0.323	0.619	A4JYH1.pdb.gz
4	AFDB:F1R2D2	0.439	0.430	0.000	1687	0.704	0.689	F1R2D2.pdb.gz
5	AFDB:O55005	0.469	0.469	0.000	1651	0.944	0.944	O55005.pdb.gz	ROBO1_RAT Roundabout homolog 1 OS=Rattus norvegicus OX=10116 GN=Robo1 PE=1 SV=1
6	AFDB:Q96MS0	0.364	0.420	0.000	1386	0.333	0.397	Q96MS0.pdb.gz	ROBO3_HUMAN Roundabout homolog 3 OS=Homo sapiens OX=9606 GN=ROBO3 PE=1 SV=2
7	AFDB:Q9Z2I4	0.297	0.349	0.000	1366	0.335	0.405	Q9Z2I4.pdb.gz	ROBO3_MOUSE Roundabout homolog 3 OS=Mus musculus OX=10090 GN=Robo3 PE=1 SV=2
8	AFDB:Q9W213	0.278	0.316	4.907E-100	1395	0.245	0.290	Q9W213.pdb.gz	Q9W213_DROME Roundabout 1, isoform A OS=Drosophila melanogaster OX=7227 GN=robo1 PE=1 SV=3
9	AFDB:Q967D7	0.135	0.143	4.329E-52	1531	0.170	0.183	Q967D7.pdb.gz	TUTL_DROME Protein turtle OS=Drosophila melanogaster OX=7227 GN=tutl PE=1 SV=2
10	AFDB:M9NE05	0.163	0.128	1.998E-34	2192	0.152	0.115	M9NE05.pdb.gz	M9NE05_DROME Neuromusculin, isoform E OS=Drosophila melanogaster OX=7227 GN=nrm PE=4 SV=1
11	PDB:5oj2B	0.100	0.208	3.734E-28	692	0.076	0.182	5oj2B.pdb.gz
12	PDB:1e07A	0.132	0.267	4.852E-22	642	0.069	0.178	1e07A.pdb.gz
13	PDB:7q1yA	0.068	0.078	1.165E-15	1374	0.061	0.073	7q1yA.pdb.gz
14	PDB:7q5zA	0.070	0.081	1.125E-14	1344	0.055	0.067	7q5zA.pdb.gz
15	PDB:7sqcO0	0.114	0.149	1.493E-14	1140	0.060	0.087	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
16	PDB:6dldD	0.095	0.517	1.891E-14	269	0.041	0.253	6dldD.pdb.gz
17	PDB:7vonA	0.070	0.079	2.542E-13	1399	0.059	0.070	7vonA.pdb.gz
18	PDB:4ziqA	0.073	0.081	2.929E-13	1450	0.055	0.062	4ziqA.pdb.gz
19	PDB:5a42A	0.076	0.078	4.481E-13	1597	0.061	0.063	5a42A.pdb.gz
20	PDB:6dlfA	0.093	0.568	7.898E-13	236	0.038	0.263	6dlfA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A024B7I3	1311	1206	0.420	0.575	A0A024B7I3_CHICK Roundabout-like protein 2 OS=Gallus gallus OX=9031 GN=ROBO2 PE=2 SV=1
2	A0A087WZ85	3124	1525	0.920	0.996	A0A087WZ85_HUMAN Roundabout guidance receptor 1 OS=Homo sapiens OX=9606 GN=ROBO1 PE=1 SV=1
3	A0A0A0MSX4	3152	1531	0.925	0.998	A0A0A0MSX4_HUMAN Roundabout guidance receptor 1 OS=Homo sapiens OX=9606 GN=ROBO1 PE=1 SV=1
4	A0A0G2JZA1	1325	1472	0.434	0.487	A0A0G2JZA1_RAT Roundabout guidance receptor 2 OS=Rattus norvegicus OX=10116 GN=Robo2 PE=4 SV=2
5	A0A1W2Q6F3	1359	1512	0.445	0.486	A0A1W2Q6F3_RAT Roundabout guidance receptor 2 OS=Rattus norvegicus OX=10116 GN=Robo2 PE=4 SV=2
6	A0A2R8QRK0	1224	1420	0.410	0.477	A0A2R8QRK0_DANRE Roundabout homolog 3 isoform X3 OS=Danio rerio OX=7955 GN=cb503 PE=1 SV=1
7	A0A8I6A1P7	1330	1377	0.435	0.521	A0A8I6A1P7_RAT Roundabout guidance receptor 2 OS=Rattus norvegicus OX=10116 GN=Robo2 PE=4 SV=1
8	A0A8I6AKD6	1324	1381	0.435	0.520	A0A8I6AKD6_RAT Roundabout guidance receptor 2 OS=Rattus norvegicus OX=10116 GN=Robo2 PE=4 SV=1
9	A8DZ85	1222	1389	0.409	0.486	A8DZ85_DANRE Roundabout homolog 3 OS=Danio rerio OX=7955 GN=cb503 PE=1 SV=1
10	D3Z4M6	922	1402	0.286	0.337	D3Z4M6_MOUSE Roundabout guidance receptor 3 OS=Mus musculus OX=10090 GN=Robo3 PE=1 SV=1
11	F1M950	1400	1533	0.487	0.524	F1M950_RAT Roundabout guidance receptor 2 OS=Rattus norvegicus OX=10116 GN=Robo2 PE=4 SV=4
12	F1QFK4	1224	1419	0.410	0.477	F1QFK4_DANRE Roundabout homolog 3 isoform 1 OS=Danio rerio OX=7955 GN=cb503 PE=1 SV=1
13	O55005	2996	1651	0.939	0.939	ROBO1_RAT Roundabout homolog 1 OS=Rattus norvegicus OX=10116 GN=Robo1 PE=1 SV=1
14	O89026	2903	1612	0.918	0.940	ROBO1_MOUSE Roundabout homolog 1 OS=Mus musculus OX=10090 GN=Robo1 PE=1 SV=1
15	Q2M1J3	3258	1607	0.960	0.986	Q2M1J3_HUMAN ROBO1 protein OS=Homo sapiens OX=9606 GN=ROBO1 PE=1 SV=1
16	Q7TPD3	1326	1470	0.434	0.488	ROBO2_MOUSE Roundabout homolog 2 OS=Mus musculus OX=10090 GN=Robo2 PE=1 SV=2
17	Q8UVD7	2632	1614	0.826	0.845	Q8UVD7_XENLA Roundabout guidance receptor 1 L homeolog precursor OS=Xenopus laevis OX=8355 GN=robo1.L PE=2 SV=1
18	Q90Z42	642	330	0.187	0.936	Q90Z42_CHICK Roundabout1 protein (Fragment) OS=Gallus gallus OX=9031 GN=ROBO1 PE=2 SV=1
19	Q90Z70	1368	1513	0.449	0.490	Q90Z70_DANRE Robo2 OS=Danio rerio OX=7955 GN=sb:eu937 PE=2 SV=1
20	Q96MS0	937	1386	0.300	0.358	ROBO3_HUMAN Roundabout homolog 3 OS=Homo sapiens OX=9606 GN=ROBO3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08205 C2-set_2	2.1e-14	64.7	CD80-like C2-set immunoglobulin domain
2	PF00041 fn3	3e-31	118.9	Fibronectin type III domain
3	PF07679 I-set	8.7e-87	296.7	Immunoglobulin I-set domain
4	PF00047 ig	3.6e-44	160.2	Immunoglobulin domain
5	PF13895 Ig_2	4.1e-46	166.5	Immunoglobulin domain
6	PF13927 Ig_3	1.2e-78	271.0	Immunoglobulin domain
7	PF16681 Ig_5	4.2e-05	35.2	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
8	PF17736 Ig_C17orf99	0.00022	32.5	C17orf99 Ig domain
9	PF06328 Lep_receptor_Ig	4.3e+02	12.3	Ig-like C2-type domain
10	PF16656 Pur_ac_phosph_N	4	19.5	Purple acid Phosphatase, N-terminal domain
11	PF07686 V-set	1.3e-24	97.8	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000420321

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000332164	0.999	Slit homolog 3 protein
2	9606.ENSP00000422591	0.999	Slit homolog 2 protein
3	9606.ENSP00000266058	0.997	Slit homolog 1 protein
4	9606.ENSP00000347198	0.996	SLIT-ROBO Rho GTPase-activating protein 1
5	9606.ENSP00000359829	0.993	Ubiquitin carboxyl-terminal hydrolase 33
6	9606.ENSP00000459615	0.981	SLIT-ROBO Rho GTPase-activating protein 2
7	9606.ENSP00000361423	0.957	Tyrosine-protein kinase ABL1
8	9606.ENSP00000383118	0.948	Cell division control protein 42 homolog
9	9606.ENSP00000344456	0.939	Catenin beta-1
10	9606.ENSP00000269141	0.937	Cadherin-2
11	9606.ENSP00000400175	0.935	Transforming protein RhoA
12	9606.ENSP00000373347	0.934	SLIT-ROBO Rho GTPase-activating protein 3
13	9606.ENSP00000348461	0.918	Ras-related C3 botulinum toxin substrate 1
14	9606.ENSP00000362717	0.917	LIM/homeobox protein Lhx2
15	9606.ENSP00000304669	0.908	Catenin alpha-1
16	9606.ENSP00000382004	0.906	Catenin delta-1
17	9606.ENSP00000304697	0.903	Polyubiquitin-B
18	9606.ENSP00000441543	0.902	Polyubiquitin-C
19	9606.ENSP00000256925	0.900	CDK5 and ABL1 enzyme substrate 1
20	9606.ENSP00000272317	0.900	Ubiquitin-40S ribosomal protein S27a

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0038023	0.803	signaling receptor activity
GO:0004888	0.784	transmembrane signaling receptor activity
GO:0008046	0.561	axon guidance receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050896	0.990	response to stimulus
GO:0032501	0.990	multicellular organismal process
GO:0048856	0.979	anatomical structure development
GO:0007275	0.973	multicellular organism development
GO:0048731	0.964	system development
GO:0040011	0.961	locomotion
GO:0009653	0.954	anatomical structure morphogenesis
GO:0050789	0.945	regulation of biological process
GO:0071840	0.908	cellular component organization or biogenesis
GO:0050794	0.900	regulation of cellular process
GO:0006935	0.892	chemotaxis
GO:0007399	0.882	nervous system development
GO:0048869	0.876	cellular developmental process
GO:0016043	0.869	cellular component organization
GO:0048468	0.866	cell development
GO:0031175	0.852	neuron projection development
GO:0032989	0.847	cellular component morphogenesis
GO:0061564	0.841	axon development
GO:0120039	0.840	plasma membrane bounded cell projection morphogenesis
GO:0048812	0.833	neuron projection morphogenesis
GO:0000904	0.786	cell morphogenesis involved in differentiation
GO:0048667	0.730	cell morphogenesis involved in neuron differentiation
GO:0007409	0.655	axonogenesis
GO:0097485	0.604	neuron projection guidance
GO:0007411	0.588	axon guidance
GO:0051128	0.329	regulation of cellular component organization
GO:0048518	0.315	positive regulation of biological process
GO:0048583	0.303	regulation of response to stimulus
GO:0048519	0.301	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.821	intracellular anatomical structure
GO:0005737	0.799	cytoplasm
GO:0120025	0.753	plasma membrane bounded cell projection
GO:0043005	0.630	neuron projection
GO:0043226	0.557	organelle
GO:0030424	0.529	axon
GO:0005829	0.474	cytosol
GO:0043227	0.468	membrane-bounded organelle
GO:0043231	0.382	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]