StarFunc result for job id Q9Y6Q3

User Input

>input (630 residues)
MSVSSGVQILTKPETVDRRRSAETTKEAGRPLEMAVSEPEASAAEWKQLDPAQSNLYNDV
MLENYCNQASMGCQAPKPDMISKLEKGEAPWLGKGKRPSQGCPSKIARPKQKETDGKVQK
DDDQLENIQKSQNKLLREVAVKKKTQAKKNGSDCGSLGKKNNLHKKHVPSKKRLLKFESC
GKILKQNLDLPDHSRNCVKRKSDAAKEHKKSFNHSLSDTRKGKKQTGKKHEKLSSHSSSD
KCNKTGKKHDKLCCHSSSHIKQDKIQTGEKHEKSPSLSSSTKHEKPQACVKPYECNQCGK
VLSHKQGLIDHQRVHTGEKPYECNECGIAFSQKSHLVVHQRTHTGEKPYECIQCGKAHGH
KHALTDHLRIHTGEKPYECAECGKTFRHSSNLIQHVRSHTGEKPYECKECGKSFRYNSSL
TEHVRTHTGEIPYECNECGKAFKYSSSLTKHMRIHTGEKPFECNECGKAFSKKSHLIIHQ
RTHTKEKPYKCNECGKAFGHSSSLTYHMRTHTGESPFECNQCGKGFKQIEGLTQHQRVHT
GEKPYECNECGKAFSQKSHLIVHQRTHTGEKPYECNECEKAFNAKSQLVIHQRSHTGEKP
YECNECGKTFKQNASLTKHVKTHSEDKSHE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O88553	0.458	0.477	3.680E-64	601	0.660	0.692	O88553.pdb.gz	ZFP37_RAT Zinc finger protein 37 OS=Rattus norvegicus OX=10116 GN=Zfp37 PE=1 SV=1
2	AFDB:Q06732	0.305	0.250	6.002E-53	778	0.460	0.373	Q06732.pdb.gz	ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens OX=9606 GN=ZNF33B PE=1 SV=2
3	AFDB:A0A024R4S7	0.440	0.359	1.414E-52	792	0.446	0.355	A0A024R4S7.pdb.gz
4	AFDB:Q9UJW8	0.434	0.401	1.678E-52	692	0.438	0.399	Q9UJW8.pdb.gz	ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens OX=9606 GN=ZNF180 PE=1 SV=2
5	AFDB:A0A0A0MS50	0.439	0.456	2.503E-52	604	0.441	0.460	A0A0A0MS50.pdb.gz	A0A0A0MS50_HUMAN Zinc finger protein 300 OS=Homo sapiens OX=9606 GN=ZNF300 PE=1 SV=1
6	AFDB:Q14587	0.285	0.195	4.879E-51	947	0.440	0.293	Q14587.pdb.gz	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
7	AFDB:P51523	0.456	0.395	1.619E-50	738	0.433	0.370	P51523.pdb.gz	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
8	AFDB:P51814	0.401	0.317	4.038E-50	821	0.433	0.333	P51814.pdb.gz	ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens OX=9606 GN=ZNF41 PE=1 SV=2
9	AFDB:Q6ECI4	0.457	0.407	1.888E-49	717	0.413	0.363	Q6ECI4.pdb.gz	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
10	AFDB:P15622	0.459	0.510	1.999E-49	560	0.405	0.455	P15622.pdb.gz	ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens OX=9606 GN=ZNF250 PE=1 SV=3
11	PDB:3w5kB	0.085	0.281	1.084E-4	110	0.065	0.373	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:4fjcE	0.054	0.071	3.221E-1	434	0.063	0.092	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
13	PDB:5dkaA	0.050	0.251	7.167E-1	96	0.027	0.177	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
14	PDB:6o9lQ	0.042	0.055	1.069	430	0.062	0.091	6o9lQ.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
15	PDB:6ydhA	0.030	0.185	1.198	62	0.022	0.226	6ydhA.pdb.gz
16	PDB:7ad8D	0.048	0.081	1.343	280	0.049	0.111	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
17	PDB:7qcdD	0.064	0.092	1.595	326	0.041	0.080	7qcdD.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
18	PDB:5c8dE	0.069	0.102	1.787	280	0.029	0.064	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.
19	PDB:7ena4	0.069	0.082	1.787	457	0.052	0.072	7ena4.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
20	PDB:7ktsD	0.056	0.103	1.893	219	0.048	0.137	7ktsD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O88553	0.0	798	601	0.675	0.707	ZFP37_RAT Zinc finger protein 37 OS=Rattus norvegicus OX=10116 GN=Zfp37 PE=1 SV=1
2	P17141	0.0	831	594	0.697	0.739	ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus OX=10090 GN=Zfp37 PE=2 SV=4
3	P51523	0.0	534	738	0.470	0.401	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
4	Q5MCW4	0.0	530	686	0.476	0.437	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
5	Q96RE9	1.46e-174	511	604	0.475	0.495	ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens OX=9606 GN=ZNF300 PE=1 SV=1
6	A0A0A0MS50	1.73e-174	511	604	0.475	0.495	A0A0A0MS50_HUMAN Zinc finger protein 300 OS=Homo sapiens OX=9606 GN=ZNF300 PE=1 SV=1
7	P52742	2.22e-170	502	658	0.465	0.445	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
8	P51814	3.78e-166	497	821	0.471	0.362	ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens OX=9606 GN=ZNF41 PE=1 SV=2
9	Q6ECI4	3.58e-164	488	717	0.441	0.388	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
10	Q14587	8.01e-164	495	947	0.465	0.309	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
11	P17014	2.51e-162	483	697	0.463	0.419	ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens OX=9606 GN=ZNF12 PE=1 SV=3
12	Q8WXB4	7.72e-161	482	792	0.449	0.357	ZN606_HUMAN Zinc finger protein 606 OS=Homo sapiens OX=9606 GN=ZNF606 PE=2 SV=1
13	O94892	4.50e-158	471	652	0.451	0.436	ZN432_HUMAN Zinc finger protein 432 OS=Homo sapiens OX=9606 GN=ZNF432 PE=1 SV=1
14	Q8N184	2.22e-157	469	647	0.437	0.425	ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens OX=9606 GN=ZNF567 PE=1 SV=3
15	Q9UJW8	1.72e-155	465	692	0.454	0.413	ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens OX=9606 GN=ZNF180 PE=1 SV=2
16	Q9P2J8	2.97e-155	470	865	0.432	0.314	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
17	Q96NL3	2.68e-154	459	588	0.405	0.434	ZN599_HUMAN Zinc finger protein 599 OS=Homo sapiens OX=9606 GN=ZNF599 PE=1 SV=1
18	P35789	3.80e-154	459	620	0.429	0.435	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
19	Q6ZN57	1.74e-153	452	461	0.346	0.473	ZFP2_HUMAN Zinc finger protein ZFP2 OS=Homo sapiens OX=9606 GN=ZFP2 PE=1 SV=1
20	Q8TAQ5	2.95e-153	459	688	0.438	0.401	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16526 CLZ	1.6e+02	14.1	C-terminal leucine zipper domain of cyclic nucleotide-gated channels
2	PF20026 DUF6434	2.1	19.7	Domain of unknown function (DUF6434)
3	PF00320 GATA	0.45	21.5	GATA zinc finger
4	PF12833 HTH_18	7.5e+02	11.8	Helix-turn-helix domain
5	PF01352 KRAB	3.5e-09	47.4	KRAB box
6	PF01286 XPA_N	46	15.5	XPA protein N-terminal
7	PF01428 zf-AN1	8.6	17.9	AN1-like Zinc finger
8	PF00096 zf-C2H2	1.8e-66	228.2	Zinc finger, C2H2 type
9	PF16622 zf-C2H2_11	0.057	24.5	zinc-finger C2H2-type
10	PF13894 zf-C2H2_4	4.7e-34	125.1	C2H2-type zinc finger
11	PF13912 zf-C2H2_6	1.2e-20	84.2	C2H2-type zinc finger
12	PF12171 zf-C2H2_jaz	7.9e-06	37.3	Zinc-finger double-stranded RNA-binding
13	PF16278 zf-C2HE	5.3e+02	12.5	C2HE / C2H2 / C2HC zinc-binding finger
14	PF13465 zf-H2C2_2	8.3e-97	325.0	Zinc-finger double domain
15	PF12874 zf-met	57	15.5	Zinc-finger of C2H2 type
16	PF18439 zf_UBZ	8.1	17.5	Ubiquitin-Binding Zinc Finger
17	PF17032 zinc_ribbon_15	2	20.6	zinc-ribbon family
18	PF09723 Zn-ribbon_8	5.9e-07	40.8	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000452552

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363345	0.778	Thymic stromal cotransporter homolog
2	9606.ENSP00000259392	0.736	Probable low affinity copper uptake protein 2
3	9606.ENSP00000354633	0.736	Transcription initiation factor TFIID subunit 11
4	9606.ENSP00000238256	0.725	FK506-binding protein 15
5	9606.ENSP00000417480	0.725	Bis(5'-adenosyl)-triphosphatase
6	9606.ENSP00000319281	0.686	Brain abundant membrane attached signal protein 1
7	9606.ENSP00000356641	0.659	E3 ubiquitin-protein ligase RFWD2
8	9606.ENSP00000477868	0.657	TOX high mobility group box family member 4
9	9606.ENSP00000354481	0.650	BMP/retinoic acid-inducible neural-specific protein 2
10	9606.ENSP00000271628	0.635	Splicing factor 3B subunit 4
11	9606.ENSP00000234160	0.596	Golgi reassembly-stacking protein 2
12	9606.ENSP00000357484	0.596	Golgi-associated PDZ and coiled-coil motif-containing protein
13	9606.ENSP00000265560	0.589	Ubiquitin carboxyl-terminal hydrolase 4
14	9606.ENSP00000371607	0.579	Mitochondrial intermediate peptidase
15	9606.ENSP00000320949	0.574	CCR4-NOT transcription complex subunit 1
16	9606.ENSP00000413496	0.571	Fibroblast growth factor 12
17	9606.ENSP00000260403	0.545	Transmembrane protein 62
18	9606.ENSP00000468633	0.544	Signal peptidase complex catalytic subunit SEC11C
19	9606.ENSP00000255977	0.542	E3 ubiquitin-protein ligase makorin-1
20	9606.ENSP00000405890	0.535	Pre-B-cell leukemia transcription factor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.857	nucleic acid binding
GO:0003677	0.767	DNA binding
GO:1990837	0.738	sequence-specific double-stranded DNA binding
GO:0140110	0.509	transcription regulator activity
GO:0000976	0.436	transcription cis-regulatory region binding
GO:0003700	0.363	DNA-binding transcription factor activity
GO:0000977	0.312	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.959	regulation of biological process
GO:0050794	0.944	regulation of cellular process
GO:0019222	0.831	regulation of metabolic process
GO:0009987	0.818	cellular process
GO:0080090	0.813	regulation of primary metabolic process
GO:0060255	0.809	regulation of macromolecule metabolic process
GO:0051171	0.807	regulation of nitrogen compound metabolic process
GO:0031323	0.718	regulation of cellular metabolic process
GO:0010468	0.708	regulation of gene expression
GO:0019219	0.697	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.678	regulation of DNA-templated transcription
GO:0048519	0.525	negative regulation of biological process
GO:0048523	0.521	negative regulation of cellular process
GO:0009892	0.417	negative regulation of metabolic process
GO:0010605	0.403	negative regulation of macromolecule metabolic process
GO:0032502	0.392	developmental process
GO:0051172	0.375	negative regulation of nitrogen compound metabolic process
GO:0031324	0.348	negative regulation of cellular metabolic process
GO:0006357	0.314	regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.991	cytoplasm
GO:0070013	0.985	intracellular organelle lumen
GO:0005654	0.975	nucleoplasm
GO:0005829	0.974	cytosol
GO:0043232	0.388	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]