StarFunc result for job id Q9Y6Q6

User Input

>input (616 residues)
MAPRARRRRPLFALLLLCALLARLQVALQIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKC
TTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHW
SQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGK
RVEHHGTEKSDAVCSSSLPARKPPNEPHVYLPGLIILLLFASVALVAAIIFGVCYRKKGK
ALTANLWHWINEACGRLSGDKESSGDSCVSTHTANFGQQGACEGVLLLTLEEKTFPEDMC
YPDQGGVCQGTCVGGGPYAQGEDARMLSLVSKTEIEEDSFRQMPTEDEYMDRPSQPTDQL
LFLTEPGSKSTPPFSEPLEVGENDSLSQCFTGTQSTVGSESCNCTEPLCRTDWTPMSSEN
YLQKEVDSGHCPHWAASPSPNWADVCTGCRNPPGEDCEPLVGSPKRGPLPQCAYGMGLPP
EEEASRTEARDQPEDGADGRLPSSARAGAGSGSSPGGQSPASGNVTGNSNSTFISSGQVM
NFKGDIIVVYVSQTSQEGAAAAAEPMGRPVQEETLARRDSFAGNGPRFPDPCGGPEGLRE
PEKASRPVQEQGGAKA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y6Q6	1.000	1.000	2.671E-90	616	1.000	1.000	Q9Y6Q6.pdb.gz	TNR11_HUMAN Tumor necrosis factor receptor superfamily member 11A OS=Homo sapiens OX=9606 GN=TNFRSF11A PE=1 SV=1
2	AFDB:F1M8Z6	0.347	0.338	2.702E-63	633	0.688	0.670	F1M8Z6.pdb.gz	F1M8Z6_RAT TNF receptor superfamily member 11A OS=Rattus norvegicus OX=10116 GN=Tnfrsf11a PE=4 SV=2
3	AFDB:A0A0R4IFE6	0.096	0.089	2.669E-1	687	0.143	0.128	A0A0R4IFE6.pdb.gz	A0A0R4IFE6_DANRE Neuregulin 1 OS=Danio rerio OX=7955 GN=wu:fm70e01 PE=3 SV=1
4	AFDB:Q05BQ1	0.049	0.043	3.182E-1	1179	0.131	0.069	Q05BQ1.pdb.gz	TUTLA_MOUSE Protein turtle homolog A OS=Mus musculus OX=10090 GN=Igsf9 PE=1 SV=2
5	AFDB:Q9SE97	0.045	0.028	3.182E-1	1051	0.153	0.089	Q9SE97.pdb.gz	FH1_ARATH Formin-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=FH1 PE=1 SV=1
6	AFDB:Q9W3Q5	0.056	0.036	3.374E-1	1268	0.136	0.066	Q9W3Q5.pdb.gz	Q9W3Q5_DROME Checkpoint suppressor 1-like, isoform A OS=Drosophila melanogaster OX=7227 GN=CHES-1-like PE=4 SV=4
7	AFDB:Q5FBB7	0.086	0.093	3.577E-1	561	0.109	0.119	Q5FBB7.pdb.gz	SGO1_HUMAN Shugoshin 1 OS=Homo sapiens OX=9606 GN=SGO1 PE=1 SV=1
8	AFDB:A0A140LG84	0.053	0.035	5.714E-1	1017	0.128	0.078	A0A140LG84.pdb.gz
9	AFDB:A0A2R8RMH2	0.049	0.032	6.424E-1	1150	0.138	0.074	A0A2R8RMH2.pdb.gz
10	AFDB:Q499E5	0.062	0.044	6.812E-1	926	0.174	0.116	Q499E5.pdb.gz	STOX2_MOUSE Storkhead-box protein 2 OS=Mus musculus OX=10090 GN=Stox2 PE=2 SV=2
11	PDB:7dtvA	0.095	0.079	1.806	779	0.029	0.023	7dtvA.pdb.gz	Structural mechanism of cooperative activation of the human calcium-sensing receptor by Ca 2+ ions and L-tryptophan.
12	PDB:7e9hR	0.053	0.047	2.885	766	0.028	0.022	7e9hR.pdb.gz	Structures of G i -bound metabotropic glutamate receptors mGlu2 and mGlu4.
13	PDB:4hpqB	0.040	0.194	3.059	115	0.026	0.139	4hpqB.pdb.gz
14	PDB:7wihA	0.043	0.038	3.059	741	0.031	0.026	7wihA.pdb.gz	Structural basis of the activation of metabotropic glutamate receptor 3.
15	PDB:4mspA	0.044	0.094	4.887	189	0.019	0.063	4mspA.pdb.gz	Structure of human peptidyl-prolyl cis-trans isomerase FKBP22 containing two EF-hand motifs.
16	PDB:4v8mBj	0.077	0.254	4.887	161	0.024	0.093	4v8mBj.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
17	PDB:4p1wB	0.040	0.172	5.181	135	0.031	0.141	4p1wB.pdb.gz	Structural basis of starvation-induced assembly of the autophagy initiation complex.
18	PDB:5cvnB	0.042	0.058	5.181	321	0.008	0.016	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
19	PDB:3ehqA	0.039	0.094	5.494	182	0.006	0.022	3ehqA.pdb.gz
20	PDB:7kahD	0.031	0.037	5.825	493	0.010	0.012	7kahD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1M8Z6	0.0	752	633	0.682	0.664	F1M8Z6_RAT TNF receptor superfamily member 11A OS=Rattus norvegicus OX=10116 GN=Tnfrsf11a PE=4 SV=2
2	O35305	0.0	796	625	0.674	0.664	TNR11_MOUSE Tumor necrosis factor receptor superfamily member 11A OS=Mus musculus OX=10090 GN=Tnfrsf11a PE=1 SV=1
3	Q9Y6Q6	0.0	1265	616	1.000	1.000	TNR11_HUMAN Tumor necrosis factor receptor superfamily member 11A OS=Homo sapiens OX=9606 GN=TNFRSF11A PE=1 SV=1
4	P25942	5.93e-37	141	277	0.130	0.289	TNR5_HUMAN Tumor necrosis factor receptor superfamily member 5 OS=Homo sapiens OX=9606 GN=CD40 PE=1 SV=1
5	P27512	1.59e-31	126	289	0.127	0.270	TNR5_MOUSE Tumor necrosis factor receptor superfamily member 5 OS=Mus musculus OX=10090 GN=Cd40 PE=1 SV=3
6	A0A8I6AHI1	2.62e-31	126	309	0.117	0.233	A0A8I6AHI1_RAT Tumor necrosis factor receptor superfamily member 5 OS=Rattus norvegicus OX=10116 GN=Cd40 PE=4 SV=1
7	A0A8I6A4J5	8.81e-30	120	260	0.114	0.269	A0A8I6A4J5_RAT Tumor necrosis factor receptor superfamily member 5 OS=Rattus norvegicus OX=10116 GN=Cd40 PE=4 SV=1
8	F6SVZ3	1.75e-29	119	269	0.102	0.234	F6SVZ3_RAT Tumor necrosis factor receptor superfamily member 5 OS=Rattus norvegicus OX=10116 GN=Cd40 PE=4 SV=1
9	A0A8I5XVD8	2.33e-26	108	204	0.097	0.294	A0A8I5XVD8_RAT CD40 molecule OS=Rattus norvegicus OX=10116 GN=Cd40 PE=4 SV=1
10	P25119	1.01e-19	94.7	474	0.101	0.131	TNR1B_MOUSE Tumor necrosis factor receptor superfamily member 1B OS=Mus musculus OX=10090 GN=Tnfrsf1b PE=2 SV=1
11	Q71F55	1.40e-19	91.3	276	0.110	0.246	Q71F55_MOUSE Herpes virus entry mediator OS=Mus musculus OX=10090 GN=Tnfrsf14 PE=1 SV=1
12	Q80WM9	1.96e-19	90.9	275	0.117	0.262	TNR14_MOUSE Tumor necrosis factor receptor superfamily member 14 OS=Mus musculus OX=10090 GN=Tnfrsf14 PE=1 SV=1
13	P36941	3.67e-19	92.8	435	0.106	0.149	TNR3_HUMAN Tumor necrosis factor receptor superfamily member 3 OS=Homo sapiens OX=9606 GN=LTBR PE=1 SV=1
14	P20333	1.07e-18	91.7	461	0.099	0.132	TNR1B_HUMAN Tumor necrosis factor receptor superfamily member 1B OS=Homo sapiens OX=9606 GN=TNFRSF1B PE=1 SV=3
15	O00300	2.08e-18	90.1	401	0.104	0.160	TR11B_HUMAN Tumor necrosis factor receptor superfamily member 11B OS=Homo sapiens OX=9606 GN=TNFRSF11B PE=1 SV=3
16	O08727	2.86e-18	89.7	401	0.114	0.175	TR11B_RAT Tumor necrosis factor receptor superfamily member 11B OS=Rattus norvegicus OX=10116 GN=Tnfrsf11b PE=2 SV=1
17	F1RAS9	2.96e-17	86.7	425	0.094	0.136	F1RAS9_DANRE Tumor necrosis factor receptor superfamily, member 1B OS=Danio rerio OX=7955 GN=tnfrsf1b PE=4 SV=2
18	Q80WY6	4.58e-17	86.7	474	0.094	0.122	TNR1B_RAT Tumor necrosis factor receptor superfamily member 1B OS=Rattus norvegicus OX=10116 GN=Tnfrsf1b PE=2 SV=1
19	O08712	9.62e-16	82.0	401	0.107	0.165	TR11B_MOUSE Tumor necrosis factor receptor superfamily member 11B OS=Mus musculus OX=10090 GN=Tnfrsf11b PE=1 SV=1
20	B8X730	5.15e-15	78.2	286	0.094	0.203	B8X730_DANRE CD40 molecule, TNF receptor superfamily member 5 OS=Danio rerio OX=7955 GN=si:ch211-231h20.3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05454 DAG1	51	14.7	Dystroglycan (Dystrophin-associated glycoprotein 1)
2	PF02172 KIX	4.6e+02	12.5	KIX domain
3	PF18278 RANK_CRD_2	4.2e-20	82.9	Receptor activator of the NF-KB cysteine-rich repeat domain 2
4	PF00020 TNFR_c6	3.8e-09	48.2	TNFR/NGFR cysteine-rich region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000465500

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000381775	0.999	Tumor necrosis factor ligand superfamily member 11
2	9606.ENSP00000433623	0.998	TNF receptor-associated factor 6
3	9606.ENSP00000247668	0.980	TNF receptor-associated factor 2
4	9606.ENSP00000306245	0.938	Proto-oncogene c-Fos
5	9606.ENSP00000454207	0.909	TNF receptor-associated factor 3
6	9606.ENSP00000261464	0.857	TNF receptor-associated factor 5
7	9606.ENSP00000362994	0.824	TNF receptor-associated factor 1
8	9606.ENSP00000398698	0.793	Tumor necrosis factor
9	9606.ENSP00000387261	0.764	Proline-serine-threonine phosphatase-interacting protein 2
10	9606.ENSP00000469049	0.762	Tumor necrosis factor ligand superfamily member 14
11	9606.ENSP00000410481	0.750	Lymphotoxin-beta
12	9606.ENSP00000468767	0.710	Tartrate-resistant acid phosphatase type 5
13	9606.ENSP00000326737	0.707	Tumor necrosis factor receptor superfamily member 12A
14	9606.ENSP00000359663	0.703	CD40 ligand
15	9606.ENSP00000482657	0.697	Mitogen-activated protein kinase kinase kinase 14
16	9606.ENSP00000365048	0.682	Tumor necrosis factor ligand superfamily member 13B
17	9606.ENSP00000271651	0.668	Cathepsin K
18	9606.ENSP00000403495	0.652	Lymphotoxin-alpha
19	9606.ENSP00000228918	0.651	Tumor necrosis factor receptor superfamily member 3
20	9606.ENSP00000291232	0.650	Tumor necrosis factor receptor superfamily member 13C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004888	1.000	transmembrane signaling receptor activity
GO:0019955	0.997	cytokine binding
GO:0019899	0.589	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050896	0.995	response to stimulus
GO:0007165	0.993	signal transduction
GO:0080090	0.992	regulation of primary metabolic process
GO:0051171	0.992	regulation of nitrogen compound metabolic process
GO:0031323	0.988	regulation of cellular metabolic process
GO:0010468	0.987	regulation of gene expression
GO:0044093	0.982	positive regulation of molecular function
GO:0030097	0.980	hemopoiesis
GO:0002376	0.977	immune system process
GO:0010033	0.977	response to organic substance
GO:0048583	0.975	regulation of response to stimulus
GO:0048522	0.972	positive regulation of cellular process
GO:0007166	0.970	cell surface receptor signaling pathway
GO:0006355	0.965	regulation of DNA-templated transcription
GO:0051090	0.960	regulation of DNA-binding transcription factor activity
GO:0023051	0.957	regulation of signaling
GO:0030316	0.953	osteoclast differentiation
GO:0010646	0.951	regulation of cell communication
GO:0048584	0.936	positive regulation of response to stimulus
GO:0034097	0.931	response to cytokine
GO:0009605	0.929	response to external stimulus
GO:0051091	0.918	positive regulation of DNA-binding transcription factor activity
GO:1902533	0.911	positive regulation of intracellular signal transduction
GO:0031401	0.905	positive regulation of protein modification process
GO:0001932	0.901	regulation of protein phosphorylation
GO:0019221	0.901	cytokine-mediated signaling pathway
GO:0045937	0.899	positive regulation of phosphate metabolic process
GO:0050790	0.872	regulation of catalytic activity
GO:0043085	0.858	positive regulation of catalytic activity
GO:0042327	0.850	positive regulation of phosphorylation
GO:0071356	0.848	cellular response to tumor necrosis factor
GO:0033209	0.761	tumor necrosis factor-mediated signaling pathway
GO:0001934	0.738	positive regulation of protein phosphorylation
GO:0009719	0.737	response to endogenous stimulus
GO:0051092	0.710	positive regulation of NF-kappaB transcription factor activity
GO:0043408	0.708	regulation of MAPK cascade
GO:0051338	0.700	regulation of transferase activity
GO:0043549	0.694	regulation of kinase activity
GO:1901700	0.683	response to oxygen-containing compound
GO:0043410	0.675	positive regulation of MAPK cascade
GO:0045859	0.652	regulation of protein kinase activity
GO:0051347	0.645	positive regulation of transferase activity
GO:0032501	0.606	multicellular organismal process
GO:0033674	0.582	positive regulation of kinase activity
GO:0051239	0.539	regulation of multicellular organismal process
GO:0045860	0.533	positive regulation of protein kinase activity
GO:0071900	0.520	regulation of protein serine/threonine kinase activity
GO:0071902	0.510	positive regulation of protein serine/threonine kinase activity
GO:0043406	0.486	positive regulation of MAP kinase activity
GO:0006950	0.435	response to stress
GO:0009628	0.405	response to abiotic stimulus
GO:0008284	0.397	positive regulation of cell population proliferation
GO:0009612	0.351	response to mechanical stimulus
GO:0043506	0.343	regulation of JUN kinase activity
GO:0048519	0.336	negative regulation of biological process
GO:0048523	0.325	negative regulation of cellular process
GO:0010941	0.316	regulation of cell death
GO:0051240	0.305	positive regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005886	0.991	plasma membrane
GO:0005829	0.991	cytosol
GO:0009986	0.914	cell surface
GO:0043226	0.675	organelle
GO:0043229	0.644	intracellular organelle
GO:0043227	0.639	membrane-bounded organelle
GO:0043231	0.634	intracellular membrane-bounded organelle
GO:0098552	0.505	side of membrane
GO:0009897	0.401	external side of plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]