StarFunc result for job id Q9Y6Q9

User Input

>input (1424 residues)
MSGLGENLDPLASDSRKRKLPCDTPGQGLTCSGEKRRREQESKYIEELAELISANLSDID
NFNVKPDKCAILKETVRQIRQIKEQGKTISNDDDVQKADVSSTGQGVIDKDSLGPLLLQA
LDGFLFVVNRDGNIVFVSENVTQYLQYKQEDLVNTSVYNILHEEDRKDFLKNLPKSTVNG
VSWTNETQRQKSHTFNCRMLMKTPHDILEDINASPEMRQRYETMQCFALSQPRAMMEEGE
DLQSCMICVARRITTGERTFPSNPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRRC
IQRFFSLNDGQSWSQKRHYQEAYLNGHAETPVYRFSLADGTIVTAQTKSKLFRNPVTNDR
HGFVSTHFLQREQNGYRPNPNPVGQGIRPPMAGCNSSVGGMSMSPNQGLQMPSSRAYGLA
DPSTTGQMSGARYGGSSNIASLTPGPGMQSPSSYQNNNYGLNMSSPPHGSPGLAPNQQNI
MISPRNRGSPKIASHQFSPVAGVHSPMASSGNTGNHSFSSSSLSALQAISEGVGTSLLST
LSSPGPKLDNSPNMNITQPSKVSNQDSKSPLGFYCDQNPVESSMCQSNSRDHLSDKESKE
SSVEGAENQRGPLESKGHKKLLQLLTCSSDDRGHSSLTNSPLDSSCKESSVSVTSPSGVS
SSTSGGVSSTSNMHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSSITSCGDGN
VVKQEQLSPKKKENNALLRYLLDRDDPSDALSKELQPQVEGVDNKMSQCTSSTIPSSSQE
KDPKIKTETSEEGSGDLDNLDAILGDLTSSDFYNNSISSNGSHLGTKQQVFQGTNSLGLK
SSQSVQSIRPPYNRAVSLDSPVSVGSSPPVKNISAFPMLPKQPMLGGNPRMMDSQENYGS
SMGGPNRNVTVTQTPSSGDWGLPNSKAGRMEPMNSNSMGRPGGDYNTSLPRPALGGSIPT
LPLRSNSIPGARPVLQQQQQMLQMRPGEIPMGMGANPYGQAAASNQLGSWPDGMLSMEQV
SHGTQNRPLLRNSLDDLVGPPSNLEGQSDERALLDQLHTLLSNTDATGLEEIDRALGIPE
LVNQGQALEPKQDAFQGQEAAVMMDQKAGLYGQTYPAQGPPMQGGFHLQGQSPSFNSMMN
QMNQQGNFPLQGMHPRANIMRPRTNTPKQLRMQLQQRLQGQQFLNQSRQALELKMENPTA
GGAAVMRPMMQPQVSSQQGFLNAQMVAQRSRELLSHHFRQQRVAMMMQQQQQQQQQQQQQ
QQQQQQQQQQQQQQQQTQAFSPPPNVTASPSMDGLLAGPTMPQAPPQQFPYQPNYGMGQQ
PDPAFGRVSSPPNAMMSSRMGPSQNPMMQHPQAASIYQSSEMKGWPSGNLARNSSFSQQQ
FAHQGNPAVYSMVHMNGSSGHMGQMNMNPMPMSGMPMGPDQKYC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O09000	0.299	0.304	0.000	1398	0.805	0.820	O09000.pdb.gz	NCOA3_MOUSE Nuclear receptor coactivator 3 OS=Mus musculus OX=10090 GN=Ncoa3 PE=1 SV=2
2	AFDB:O57539	0.356	0.363	0.000	1391	0.700	0.717	O57539.pdb.gz	NCOA3_XENLA Nuclear receptor coactivator 3 OS=Xenopus laevis OX=8355 GN=ncoa3 PE=1 SV=1
3	AFDB:Q9Y6Q9	0.999	0.999	0.000	1424	1.000	1.000	Q9Y6Q9.pdb.gz	NCOA3_HUMAN Nuclear receptor coactivator 3 OS=Homo sapiens OX=9606 GN=NCOA3 PE=1 SV=1
4	AFDB:Q9WUI9	0.204	0.200	3.057E-84	1465	0.437	0.425	Q9WUI9.pdb.gz	NCOA2_RAT Nuclear receptor coactivator 2 OS=Rattus norvegicus OX=10116 GN=Ncoa2 PE=1 SV=1
5	AFDB:Q9W705	0.230	0.220	3.391E-82	1516	0.447	0.420	Q9W705.pdb.gz	NCOA2_XENLA Nuclear receptor coactivator 2 OS=Xenopus laevis OX=8355 GN=ncoa2 PE=2 SV=1
6	AFDB:Q98TW1	0.213	0.203	2.504E-80	1505	0.428	0.405	Q98TW1.pdb.gz	NCOA2_DANRE Nuclear receptor coactivator 2 OS=Danio rerio OX=7955 GN=ncoa2 PE=1 SV=1
7	AFDB:P70365	0.199	0.196	7.652E-59	1447	0.327	0.321	P70365.pdb.gz	NCOA1_MOUSE Nuclear receptor coactivator 1 OS=Mus musculus OX=10090 GN=Ncoa1 PE=1 SV=2
8	AFDB:D4A3Q3	0.118	0.118	6.526E-43	1417	0.310	0.311	D4A3Q3.pdb.gz	D4A3Q3_RAT Nuclear receptor coactivator OS=Rattus norvegicus OX=10116 GN=Ncoa1 PE=1 SV=2
9	AFDB:Q99814	0.110	0.167	1.581E-21	870	0.096	0.157	Q99814.pdb.gz	EPAS1_HUMAN Endothelial PAS domain-containing protein 1 OS=Homo sapiens OX=9606 GN=EPAS1 PE=1 SV=3
10	AFDB:E1JIM6	0.094	0.124	7.167E-21	1015	0.129	0.180	E1JIM6.pdb.gz	E1JIM6_DROME Spineless, isoform C OS=Drosophila melanogaster OX=7227 GN=ss PE=1 SV=2
11	PDB:6umzA	0.061	0.531	1.376E-3	127	0.010	0.110	6umzA.pdb.gz	Structural and spectroscopic characterization of photoactive yellow protein and photoswitchable fluorescent protein constructs containing heavy atoms.
12	PDB:6jt0A	0.033	0.067	7.425E-3	542	0.009	0.024	6jt0A.pdb.gz	Structural insights into the mechanism of human soluble guanylate cyclase.
13	PDB:2wkpA	0.063	0.231	8.340E-3	320	0.016	0.072	2wkpA.pdb.gz	A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
14	PDB:7rzwB	0.052	0.083	8.840E-3	864	0.021	0.035	7rzwB.pdb.gz	Plant phytochrome B is an asymmetric dimer with unique signalling potential.
15	PDB:7d9tA	0.034	0.076	2.668E-2	512	0.008	0.021	7d9tA.pdb.gz	Activation mechanism of human soluble guanylate cyclase by stimulators and activators.
16	PDB:4qi7A	0.033	0.055	4.007E-2	805	0.011	0.020	4qi7A.pdb.gz	Structural basis for cellobiose dehydrogenase action during oxidative cellulose degradation.
17	PDB:6r3aA	0.035	0.091	4.007E-2	323	0.024	0.105	6r3aA.pdb.gz
18	PDB:7kzpQ	0.045	0.072	7.167E-2	754	0.012	0.023	7kzpQ.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.
19	PDB:4xbiA	0.026	0.079	1.209E-1	376	0.017	0.064	4xbiA.pdb.gz
20	PDB:7nkyO	0.027	0.072	1.282E-1	427	0.013	0.044	7nkyO.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O09000	0.0	2156	1398	0.805	0.820	NCOA3_MOUSE Nuclear receptor coactivator 3 OS=Mus musculus OX=10090 GN=Ncoa3 PE=1 SV=2
2	O57539	0.0	1783	1391	0.700	0.717	NCOA3_XENLA Nuclear receptor coactivator 3 OS=Xenopus laevis OX=8355 GN=ncoa3 PE=1 SV=1
3	Q15596	0.0	953	1464	0.450	0.438	NCOA2_HUMAN Nuclear receptor coactivator 2 OS=Homo sapiens OX=9606 GN=NCOA2 PE=1 SV=2
4	Q61026	0.0	943	1462	0.451	0.439	NCOA2_MOUSE Nuclear receptor coactivator 2 OS=Mus musculus OX=10090 GN=Ncoa2 PE=1 SV=3
5	Q7TPU7	0.0	922	1393	0.443	0.453	Q7TPU7_MOUSE Nuclear receptor coactivator OS=Mus musculus OX=10090 GN=Ncoa2 PE=2 SV=1
6	Q98TW1	0.0	748	1505	0.402	0.381	NCOA2_DANRE Nuclear receptor coactivator 2 OS=Danio rerio OX=7955 GN=ncoa2 PE=1 SV=1
7	Q9EPU2	0.0	1665	1082	0.627	0.825	NCOA3_RAT Nuclear receptor coactivator 3 (Fragment) OS=Rattus norvegicus OX=10116 GN=Ncoa3 PE=2 SV=1
8	Q9W705	0.0	841	1516	0.428	0.402	NCOA2_XENLA Nuclear receptor coactivator 2 OS=Xenopus laevis OX=8355 GN=ncoa2 PE=2 SV=1
9	Q9WUI9	0.0	933	1465	0.448	0.435	NCOA2_RAT Nuclear receptor coactivator 2 OS=Rattus norvegicus OX=10116 GN=Ncoa2 PE=1 SV=1
10	Q9Y6Q9	0.0	2915	1424	1.000	1.000	NCOA3_HUMAN Nuclear receptor coactivator 3 OS=Homo sapiens OX=9606 GN=NCOA3 PE=1 SV=1
11	Q15788	4.67e-144	479	1441	0.242	0.239	NCOA1_HUMAN Nuclear receptor coactivator 1 OS=Homo sapiens OX=9606 GN=NCOA1 PE=1 SV=3
12	A0A8I6GLM3	6.41e-141	470	1443	0.238	0.235	A0A8I6GLM3_RAT Nuclear receptor coactivator OS=Rattus norvegicus OX=10116 GN=Ncoa1 PE=1 SV=1
13	P70365	2.79e-140	468	1447	0.237	0.234	NCOA1_MOUSE Nuclear receptor coactivator 1 OS=Mus musculus OX=10090 GN=Ncoa1 PE=1 SV=2
14	A0A8I6APA0	3.46e-140	468	1460	0.237	0.231	A0A8I6APA0_RAT Nuclear receptor coactivator OS=Rattus norvegicus OX=10116 GN=Ncoa1 PE=1 SV=1
15	D4A3Q3	1.47e-107	375	1417	0.217	0.218	D4A3Q3_RAT Nuclear receptor coactivator OS=Rattus norvegicus OX=10116 GN=Ncoa1 PE=1 SV=2
16	A0A0G2JZG4	1.57e-107	375	1401	0.217	0.221	A0A0G2JZG4_RAT Nuclear receptor coactivator OS=Rattus norvegicus OX=10116 GN=Ncoa1 PE=1 SV=2
17	B5MCN7	5.01e-79	288	1248	0.169	0.193	B5MCN7_HUMAN Nuclear receptor coactivator 1 OS=Homo sapiens OX=9606 GN=NCOA1 PE=1 SV=1
18	O15945	4.19e-20	99.0	642	0.067	0.148	ARNT_DROME Aryl hydrocarbon receptor nuclear translocator homolog OS=Drosophila melanogaster OX=7227 GN=tgo PE=1 SV=3
19	A0A0R4IH97	5.88e-20	98.6	631	0.072	0.162	A0A0R4IH97_DANRE Aryl hydrocarbon receptor nuclear translocator-like 2 OS=Danio rerio OX=7955 GN=bmal2 PE=4 SV=1
20	Q9IAU1	1.03e-19	97.4	575	0.072	0.177	Q9IAU1_DANRE Bmal2 OS=Danio rerio OX=7955 GN=bmal2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17096 AIM3	1.3e+02	14.9	Altered inheritance of mitochondria protein 3
2	PF07469 DUF1518	2.8e-19	80.6	Nuclear receptor coactivator, DUF1518
3	PF16279 DUF4927	6e-29	112.2	Domain of unknown function (DUF4927)
4	PF00010 HLH	9.5	17.6	Helix-loop-helix DNA-binding domain
5	PF16665 NCOA_u2	5.5e-40	147.8	Unstructured region on nuclear receptor coactivator protein
6	PF08815 Nuc_rec_co-act	1.2e-21	87.6	Nuclear receptor coactivator
7	PF00989 PAS	2.5e-05	35.6	PAS fold
8	PF14598 PAS_11	1.2e-21	88.2	PAS domain
9	PF08447 PAS_3	0.0023	29.5	PAS fold
10	PF08448 PAS_4	1.7e+02	13.8	PAS fold
11	PF13426 PAS_9	0.024	26.3	PAS domain
12	PF08832 SRC-1	4.8e-27	106.1	Steroid receptor coactivator

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361066

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262367	0.999	CREB-binding protein
2	9606.ENSP00000263253	0.999	Histone acetyltransferase p300
3	9606.ENSP00000343925	0.999	Estrogen receptor beta
4	9606.ENSP00000405330	0.999	Estrogen receptor
5	9606.ENSP00000325690	0.998	Histone-arginine methyltransferase CARM1
6	9606.ENSP00000363822	0.995	Androgen receptor
7	9606.ENSP00000254066	0.993	Retinoic acid receptor alpha
8	9606.ENSP00000325120	0.992	Progesterone receptor
9	9606.ENSP00000263754	0.991	Histone acetyltransferase KAT2B
10	9606.ENSP00000419692	0.988	Retinoic acid receptor RXR-alpha
11	9606.ENSP00000231509	0.984	Glucocorticoid receptor
12	9606.ENSP00000268712	0.980	Nuclear receptor corepressor 1
13	9606.ENSP00000447173	0.977	Vitamin D3 receptor
14	9606.ENSP00000385216	0.974	Nuclear receptor coactivator 1
15	9606.ENSP00000287820	0.972	Peroxisome proliferator-activated receptor gamma
16	9606.ENSP00000377001	0.970	Speckle-type POZ protein
17	9606.ENSP00000229795	0.969	Mitogen-activated protein kinase 14
18	9606.ENSP00000291527	0.960	Trefoil factor 1
19	9606.ENSP00000479618	0.956	Myc proto-oncogene protein
20	9606.ENSP00000399968	0.953	Nuclear receptor coactivator 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003713	1.000	transcription coactivator activity
GO:0016922	1.000	nuclear receptor binding
GO:0003824	0.991	catalytic activity
GO:0016740	0.981	transferase activity
GO:0140096	0.977	catalytic activity, acting on a protein
GO:1901363	0.948	heterocyclic compound binding
GO:0097159	0.948	organic cyclic compound binding
GO:0003677	0.939	DNA binding
GO:0008080	0.935	N-acetyltransferase activity
GO:0004402	0.931	histone acetyltransferase activity
GO:0060090	0.909	molecular adaptor activity
GO:0097718	0.898	disordered domain specific binding
GO:0043565	0.850	sequence-specific DNA binding
GO:0003690	0.827	double-stranded DNA binding
GO:1990837	0.818	sequence-specific double-stranded DNA binding
GO:0000976	0.795	transcription cis-regulatory region binding
GO:0000977	0.657	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0019899	0.629	enzyme binding
GO:0030331	0.422	nuclear estrogen receptor binding
GO:0046965	0.351	nuclear retinoid X receptor binding
GO:0044877	0.329	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006355	0.997	regulation of DNA-templated transcription
GO:0048522	0.996	positive regulation of cellular process
GO:0009987	0.990	cellular process
GO:0050896	0.989	response to stimulus
GO:0051173	0.988	positive regulation of nitrogen compound metabolic process
GO:0031325	0.988	positive regulation of cellular metabolic process
GO:0010604	0.984	positive regulation of macromolecule metabolic process
GO:0045893	0.971	positive regulation of DNA-templated transcription
GO:0006357	0.963	regulation of transcription by RNA polymerase II
GO:0042221	0.950	response to chemical
GO:0010033	0.942	response to organic substance
GO:0051716	0.928	cellular response to stimulus
GO:0045944	0.916	positive regulation of transcription by RNA polymerase II
GO:0048583	0.818	regulation of response to stimulus
GO:0070887	0.786	cellular response to chemical stimulus
GO:0032502	0.716	developmental process
GO:0009966	0.693	regulation of signal transduction
GO:0048856	0.635	anatomical structure development
GO:0033993	0.617	response to lipid
GO:0071704	0.593	organic substance metabolic process
GO:0051239	0.590	regulation of multicellular organismal process
GO:0044238	0.583	primary metabolic process
GO:0032501	0.558	multicellular organismal process
GO:1901700	0.552	response to oxygen-containing compound
GO:0014070	0.531	response to organic cyclic compound
GO:0065009	0.524	regulation of molecular function
GO:0071310	0.513	cellular response to organic substance
GO:0048519	0.503	negative regulation of biological process
GO:0048523	0.482	negative regulation of cellular process
GO:0006807	0.457	nitrogen compound metabolic process
GO:0009719	0.434	response to endogenous stimulus
GO:0007154	0.431	cell communication
GO:0044237	0.409	cellular metabolic process
GO:0007275	0.404	multicellular organism development
GO:0043170	0.375	macromolecule metabolic process
GO:0023052	0.373	signaling
GO:0050793	0.366	regulation of developmental process
GO:0007165	0.358	signal transduction
GO:0048513	0.356	animal organ development
GO:0045595	0.319	regulation of cell differentiation
GO:0032355	0.314	response to estradiol
GO:0009892	0.303	negative regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005654	1.000	nucleoplasm
GO:0005737	0.994	cytoplasm
GO:0043232	0.964	intracellular non-membrane-bounded organelle
GO:0005829	0.962	cytosol
GO:0005667	0.939	transcription regulator complex
GO:0140513	0.910	nuclear protein-containing complex
GO:0005694	0.783	chromosome
GO:0000785	0.724	chromatin
GO:0005576	0.602	extracellular region
GO:0090575	0.562	RNA polymerase II transcription regulator complex
GO:0071944	0.325	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.981	Transferases.
EC:2.3.1.-	0.937	Transferring groups other than amino-acyl groups.
RHEA:21992	0.931	acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone]
EC:2.3.1.48	0.931	histone acetyltransferase.

[back to server]