StarFunc result for job id Q9Y6R1

User Input

>input (1079 residues)
MEDEAVLDRGASFLKHVCDEEEVEGHHTIYIGVHVPKSYRRRRRHKRKTGHKEKKEKERI
SENYSDKSDIENADESSSSILKPLISPAAERIRFILGEEDDSPAPPQLFTELDELLAVDG
QEMEWKETARWIKFEEKVEQGGERWSKPHVATLSLHSLFELRTCMEKGSIMLDREASSLP
QLVEMIVDHQIETGLLKPELKDKVTYTLLRKHRHQTKKSNLRSLADIGKTVSSASRMFTN
PDNGSPAMTHRNLTSSSLNDISDKPEKDQLKNKFMKKLPRDAEASNVLVGEVDFLDTPFI
AFVRLQQAVMLGALTEVPVPTRFLFILLGPKGKAKSYHEIGRAIATLMSDEVFHDIAYKA
KDRHDLIAGIDEFLDEVIVLPPGEWDPAIRIEPPKSLPSSDKRKNMYSGGENVQMNGDTP
HDGGHGGGGHGDCEELQRTGRFCGGLIKDIKRKAPFFASDFYDALNIQALSAILFIYLAT
VTNAITFGGLLGDATDNMQGVLESFLGTAVSGAIFCLFAGQPLTILSSTGPVLVFERLLF
NFSKDNNFDYLEFRLWIGLWSAFLCLILVATDASFLVQYFTRFTEEGFSSLISFIFIYDA
FKKMIKLADYYPINSNFKVGYNTLFSCTCVPPDPANISISNDTTLAPEYLPTMSSTDMYH
NTTFDWAFLSKKECSKYGGNLVGNNCNFVPDITLMSFILFLGTYTSSMALKKFKTSPYFP
TTARKLISDFAIILSILIFCVIDALVGVDTPKLIVPSEFKPTSPNRGWFVPPFGENPWWV
CLAAAIPALLVTILIFMDQQITAVIVNRKEHKLKKGAGYHLDLFWVAILMVICSLMALPW
YVAATVISIAHIDSLKMETETSAPGEQPKFLGVREQRVTGTLVFILTGLSVFMAPILKFI
PMPVLYGVFLYMGVASLNGVQFMDRLKLLLMPLKHQPDFIYLRHVPLRRVHLFTFLQVLC
LALLWILKSTVAAIIFPVMILALVAVRKGMDYLFSQHDLSFLDDVIPEKDKKKKEDEKKK
KKKKGSLDSDNDDSDCPYSEKVPSIKIPMDIMEQQPFLSDSKPSDRERSPTFLERHTSC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8PYB9	0.544	0.528	0.000	1114	0.840	0.813	A0A2R8PYB9.pdb.gz
2	AFDB:E9Q3M5	0.551	0.534	0.000	1116	0.614	0.594	E9Q3M5.pdb.gz	S4A5_MOUSE Electrogenic sodium bicarbonate cotransporter 4 OS=Mus musculus OX=10090 GN=Slc4a5 PE=1 SV=1
3	AFDB:F1QHT2	0.873	0.871	0.000	1082	0.840	0.837	F1QHT2.pdb.gz
4	AFDB:O13134	0.837	0.872	0.000	1035	0.823	0.858	O13134.pdb.gz	S4A4_AMBTI Electrogenic sodium bicarbonate cotransporter 1 OS=Ambystoma tigrinum OX=8305 GN=SLC4A4 PE=2 SV=1
5	AFDB:O88343	0.890	0.890	0.000	1079	0.971	0.971	O88343.pdb.gz	S4A4_MOUSE Electrogenic sodium bicarbonate cotransporter 1 OS=Mus musculus OX=10090 GN=Slc4a4 PE=1 SV=2
6	AFDB:Q9BY07	0.538	0.511	0.000	1137	0.625	0.593	Q9BY07.pdb.gz	S4A5_HUMAN Electrogenic sodium bicarbonate cotransporter 4 OS=Homo sapiens OX=9606 GN=SLC4A5 PE=2 SV=2
7	AFDB:Q2Y0W8	0.781	0.771	1.356E-97	1093	0.522	0.515	Q2Y0W8.pdb.gz	S4A8_HUMAN Electroneutral sodium bicarbonate exchanger 1 OS=Homo sapiens OX=9606 GN=SLC4A8 PE=1 SV=1
8	AFDB:Q5DTL9	0.741	0.718	5.952E-96	1118	0.526	0.508	Q5DTL9.pdb.gz	S4A10_MOUSE Sodium-driven chloride bicarbonate exchanger OS=Mus musculus OX=10090 GN=Slc4a10 PE=1 SV=2
9	AFDB:Q9R1N3	0.713	0.637	2.097E-94	1218	0.541	0.479	Q9R1N3.pdb.gz	S4A7_RAT Sodium bicarbonate cotransporter 3 OS=Rattus norvegicus OX=10116 GN=Slc4a7 PE=1 SV=1
10	AFDB:Q8IPI3	0.739	0.673	2.808E-93	1190	0.472	0.428	Q8IPI3.pdb.gz	Q8IPI3_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=2
11	PDB:8cs9g	0.464	0.597	5.347E-60	832	0.302	0.392	8cs9g.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
12	PDB:7tvzA	0.508	0.625	4.468E-57	850	0.303	0.385	7tvzA.pdb.gz	Structure, dynamics and assembly of the ankyrin complex on human red blood cell membrane.
13	PDB:6caaA	0.425	0.937	9.334E-48	477	0.440	0.996	6caaA.pdb.gz
14	PDB:4yzfA	0.421	0.939	3.333E-33	475	0.196	0.444	4yzfA.pdb.gz	Crystal structure of the anion exchanger domain of human erythrocyte band 3.
15	PDB:5l25A	0.311	0.784	3.936E-13	399	0.102	0.276	5l25A.pdb.gz
16	PDB:7lguA	0.300	0.454	2.672E-8	680	0.058	0.093	7lguA.pdb.gz	Molecular mechanism of prestin electromotive signal amplification.
17	PDB:5i6cA	0.272	0.547	6.519E-6	480	0.064	0.144	5i6cA.pdb.gz	Structure of eukaryotic purine/H(+) symporter UapA suggests a role for homodimerization in transport activity.
18	PDB:3qe7A	0.239	0.531	6.140E-5	407	0.064	0.170	3qe7A.pdb.gz	Structure and mechanism of the uracil transporter UraA
19	PDB:7ch1A	0.285	0.444	6.416E-5	640	0.065	0.109	7ch1A.pdb.gz	Structural insights into the gating mechanism of human SLC26A9 mediated by its C-terminal sequence.
20	PDB:1a6jB	0.111	0.644	2.429E-2	157	0.024	0.166	1a6jB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A096X8J7	670	1170	0.345	0.318	B3A3_DANRE Anion exchange protein 3 OS=Danio rerio OX=7955 GN=Slc4a3 PE=2 SV=1
2	A0A2R8QD45	1751	1073	0.827	0.831	A0A2R8QD45_DANRE Anion exchange protein OS=Danio rerio OX=7955 GN=id:ibd2520 PE=1 SV=1
3	A0A494BA31	888	952	0.439	0.498	B3A4_MOUSE Anion exchange protein 4 OS=Mus musculus OX=10090 GN=Slc4a9 PE=1 SV=1
4	A0A494BAI0	719	871	0.366	0.454	A0A494BAI0_MOUSE Anion exchange protein OS=Mus musculus OX=10090 GN=Slc4a9 PE=3 SV=1
5	A0A494BAK5	804	821	0.402	0.529	A0A494BAK5_MOUSE Anion exchange protein (Fragment) OS=Mus musculus OX=10090 GN=Slc4a9 PE=3 SV=1
6	A0A494BBC3	822	918	0.419	0.492	A0A494BBC3_MOUSE Anion exchange protein OS=Mus musculus OX=10090 GN=Slc4a9 PE=3 SV=1
7	A9NIM6	692	1232	0.366	0.321	A9NIM6_DANRE Anion exchange protein OS=Danio rerio OX=7955 GN=slc4a2.1 PE=1 SV=1
8	B0S7B8	654	1228	0.351	0.309	B0S7B8_DANRE Anion exchange protein OS=Danio rerio OX=7955 GN=slc4a2 PE=3 SV=1
9	B3WFV9	843	1215	0.427	0.379	B3WFV9_CAEEL Anion exchange protein OS=Caenorhabditis elegans OX=6239 GN=abts-1 PE=1 SV=2
10	D1FTM8	554	851	0.290	0.368	D1FTM8_DANRE Anion exchange protein OS=Danio rerio OX=7955 GN=slc4a1b PE=2 SV=1
11	E9PUP3	835	929	0.425	0.494	E9PUP3_MOUSE Anion exchange protein OS=Mus musculus OX=10090 GN=Slc4a9 PE=3 SV=1
12	E9Q3M5	1292	1116	0.600	0.580	S4A5_MOUSE Electrogenic sodium bicarbonate cotransporter 4 OS=Mus musculus OX=10090 GN=Slc4a5 PE=1 SV=1
13	G5EC65	905	1119	0.441	0.425	G5EC65_CAEEL Anion exchange protein OS=Caenorhabditis elegans OX=6239 GN=abts-1 PE=1 SV=1
14	G5EDF4	902	1161	0.440	0.409	G5EDF4_CAEEL Anion exchange protein OS=Caenorhabditis elegans OX=6239 GN=abts-1 PE=1 SV=1
15	M9PB59	956	1134	0.466	0.444	M9PB59_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
16	M9PB60	949	1126	0.465	0.446	M9PB60_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
17	M9PC92	954	1086	0.463	0.460	M9PC92_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
18	M9PC95	912	1046	0.445	0.459	M9PC95_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
19	M9PCF0	926	1067	0.438	0.443	M9PCF0_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
20	M9PCT2	944	1027	0.439	0.462	M9PCT2_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07565 Band_3_cyto	6.4e-97	336.0	Band 3 cytoplasmic domain
2	PF10359 Fmp27_WPPW	1.9e+02	12.3	RNA pol II promoter Fmp27 protein domain
3	PF00955 HCO3_cotransp	4.6e-224	756.5	HCO3- transporter family
4	PF00359 PTS_EIIA_2	2.6	19.4	Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2
5	PF08399 VWA_N	3.6e+02	13.0	VWA N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008959387.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008964291.1	0.974	Adenosylhomocysteinase like 2
2	9597.XP_003804427.1	0.920	Putative adenosylhomocysteinase 2
3	9597.XP_008961229.1	0.920	Adenosylhomocysteinase like 1
4	9597.XP_008961230.1	0.920	Putative adenosylhomocysteinase 2
5	9597.XP_008954891.1	0.767	Belongs to the alpha-carbonic anhydrase family.
6	9597.XP_008965022.1	0.762	Belongs to the alpha-carbonic anhydrase family.
7	9597.XP_003829880.1	0.751	Belongs to the alpha-carbonic anhydrase family.
8	9597.XP_008969954.1	0.657	Solute carrier family 26 member 6
9	9597.XP_003817050.1	0.652	SS nuclear autoantigen 1
10	9597.XP_003804918.2	0.635	Solute carrier family 9 member A3
11	9597.XP_003831299.1	0.635	Belongs to the alpha-carbonic anhydrase family.
12	9597.XP_003809471.1	0.612	Belongs to the monovalent cation:proton antiporter 1 (CPA1) transporter (TC 2.A.36) family
13	9597.XP_008969902.1	0.599	GC, vitamin D binding protein
14	9597.XP_003833370.1	0.597	Unc-5 family C-terminal like
15	9597.XP_003808695.1	0.593	Epithelial ion channel that plays an important role in the regulation of epithelial ion and water transport and fluid homeostasis. Mediates the transport of chloride ions across the cell membrane. Channel activity is coupled to ATP hydrolysis. The ion channel is also permeable to HCO(3-)
16	9597.XP_003823811.1	0.578	Solute carrier family 12 member 3
17	9597.XP_003821185.1	0.557	Solute carrier family 26 member 7
18	9597.XP_003826812.1	0.547	Solute carrier family 12 member 2
19	9597.XP_003811254.1	0.543	Sodium-independent transporter of chloride and iodide.
20	9597.XP_003811255.1	0.540	Chloride/bicarbonate exchanger.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008510	1.000	sodium:bicarbonate symporter activity
GO:0005515	0.987	protein binding
GO:0015103	0.399	inorganic anion transmembrane transporter activity
GO:0008509	0.398	monoatomic anion transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006885	0.980	regulation of pH
GO:0051179	0.938	localization
GO:0006810	0.931	transport
GO:0071702	0.691	organic substance transport
GO:0006811	0.689	monoatomic ion transport
GO:0009987	0.622	cellular process
GO:0019725	0.528	cellular homeostasis
GO:0006820	0.444	monoatomic anion transport
GO:0050789	0.439	regulation of biological process
GO:0032502	0.401	developmental process
GO:0032501	0.377	multicellular organismal process
GO:0050794	0.373	regulation of cellular process
GO:0048856	0.367	anatomical structure development
GO:0030003	0.327	intracellular monoatomic cation homeostasis
GO:0015711	0.321	organic anion transport
GO:0030641	0.306	regulation of cellular pH

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0098590	0.942	plasma membrane region
GO:0016323	0.835	basolateral plasma membrane
GO:0043226	0.695	organelle
GO:0043227	0.666	membrane-bounded organelle
GO:0045177	0.540	apical part of cell
GO:0016324	0.526	apical plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:28695	1.000	hydrogencarbonate(in) = hydrogencarbonate(out)
RHEA:34963	1.000	Na(+)(in) = Na(+)(out)

[back to server]