StarFunc result for job id Q9Y6R7

User Input

>input (1400 residues)
MGALWSWWILWAGATLLWGLTQEASVDLKNTGREEFLTAFLQNYQLAYSKAYPRLLISSL
SESPASVSILSQADNTSKKVTVRPGESVMVNISAKAEMIGSKIFQHAVVIHSDYAISVQA
LNAKPDTAELTLLRPIQALGTEYFVLTPPGTSARNVKEFAVVAGAAGASVSVTLKGSVTF
NGKFYPAGDVLRVTLQPYNVAQLQSSVDLSGSKVTASSPVAVLSGHSCAQKHTTCNHVVE
QLLPTSAWGTHYVVPTLASQSRYDLAFVVASQATKLTYNHGGITGSRGLQAGDVVEFEVR
PSWPLYLSANVGIQVLLFGTGAIRNEVTYDPYLVLIPDVAAYCPAYVVKSVPGCEGVALV
VAQTKAISGLTIDGHAVGAKLTWEAVPGSEFSYAEVELGTADMIHTAEATTNLGLLTFGL
AKAIGYATAADCGRTVLSPVEPSCEGMQCAAGQRCQVVGGKAGCVAESTAVCRAQGDPHY
TTFDGRRYDMMGTCSYTMVELCSEDDTLPAFSVEAKNEHRGSRRVSYVGLVTVRAYSHSV
SLTRGEVGFVLVDNQRSRLPVSLSEGRLRVYQSGPRAVVELVFGLVVTYDWDCQLALSLP
ARFQDQVCGLCGNYNGDPADDFLTPDGALAPDAVEFASSWKLDDGDYLCEDGCQNNCPAC
TPGQAQHYEGDRLCGMLTKLDGPFAVCHDTLDPRPFLEQCVYDLCVVGGERLSLCRGLSA
YAQACLELGISVGDWRSPANCPLSCPANSRYELCGPACPTSCNGAAAPSNCSGRPCVEGC
VCLPGFVASGGACVPASSCGCTFQGLQLAPGQEVWADELCQRRCTCNGATHQVTCRDKQS
CPAGERCSVQNGLLGCYPDRFGTCQGSGDPHYVSFDGRRFDFMGTCTYLLVGSCGQNAAL
PAFRVLVENEHRGSQTVSYTRAVRVEARGVKVAVRREYPGQVLVDDVLQYLPFQAADGQV
QVFRQGRDAVVRTDFGLTVTYDWNARVTAKVPSSYAEALCGLCGNFNGDPADDLALRGGG
QAANALAFGNSWQEETRPGCGATEPGDCPKLDSLVAQQLQSKNECGILADPKGPFRECHS
KLDPQGAVRDCVYDRCLLPGQSGPLCDALATYAAACQAAGATVHPWRSEELCPLSCPPHS
HYEACSYGCPLSCGDLPVPGGCGSECHEGCVCDEGFALSGESCLPLASCGCVHQGTYHPP
GQTFYPGPGCDSLCHCQEGGLVSCESSSCGPHEACQPSGGSLGCVAVGSSTCQASGDPHY
TTFDGRRFDFMGTCVYVLAQTCGTRPGLHRFAVLQENVAWGNGRVSVTRVITVQVANFTL
RLEQRQWKVTVNGVDMKLPVVLANGQIRASQHGSDVVIETDFGLRVAYDLVYYVRVTVPG
NYYQQMCGLCGNYNGDPKDD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9Q0B5	0.621	0.346	0.000	2583	0.561	0.304	E9Q0B5.pdb.gz	E9Q0B5_MOUSE Fc fragment of IgG binding protein OS=Mus musculus OX=10090 GN=Fcgbp PE=1 SV=1
2	AFDB:Q28983	0.537	0.314	1.641E-93	2476	0.246	0.139	Q28983.pdb.gz	ZAN_PIG Zonadhesin OS=Sus scrofa OX=9823 GN=ZAN PE=1 SV=1
3	AFDB:O08523	0.305	0.209	3.055E-90	2155	0.239	0.155	O08523.pdb.gz	TECTA_MOUSE Alpha-tectorin OS=Mus musculus OX=10090 GN=Tecta PE=1 SV=2
4	AFDB:F1QK57	0.309	0.208	1.684E-88	2201	0.253	0.161	F1QK57.pdb.gz
5	AFDB:A0A0G2K1Y4	0.227	0.284	2.638E-58	1103	0.182	0.231	A0A0G2K1Y4.pdb.gz	A0A0G2K1Y4_RAT Mucin 5AC, oligomeric mucus/gel-forming OS=Rattus norvegicus OX=10116 GN=Muc5ac PE=4 SV=2
6	AFDB:Q98UI9	0.230	0.156	1.454E-56	2108	0.184	0.122	Q98UI9.pdb.gz	MUC5B_CHICK Mucin-5B OS=Gallus gallus OX=9031 GN=MUC5B PE=1 SV=1
7	AFDB:Q6W4X9	0.230	0.136	2.370E-56	2439	0.185	0.106	Q6W4X9.pdb.gz	MUC6_HUMAN Mucin-6 OS=Homo sapiens OX=9606 GN=MUC6 PE=1 SV=3
8	AFDB:Q3ZCN5	0.208	0.130	1.023E-54	2332	0.172	0.103	Q3ZCN5.pdb.gz	OTOGL_HUMAN Otogelin-like protein OS=Homo sapiens OX=9606 GN=OTOGL PE=1 SV=6
9	AFDB:Q80Z19	0.213	0.116	1.238E-53	2680	0.178	0.093	Q80Z19.pdb.gz	MUC2_MOUSE Mucin-2 OS=Mus musculus OX=10090 GN=Muc2 PE=1 SV=3
10	AFDB:F1NBL0	0.218	0.256	2.566E-52	1185	0.171	0.203	F1NBL0.pdb.gz	MUC6_CHICK Mucin-6 (Fragment) OS=Gallus gallus OX=9031 GN=MUC6 PE=1 SV=1
11	PDB:5a42A	0.063	0.058	1.282E-5	1597	0.053	0.046	5a42A.pdb.gz
12	PDB:7q1yA	0.052	0.053	1.552E-4	1374	0.043	0.044	7q1yA.pdb.gz
13	PDB:4ziqA	0.062	0.061	1.981E-4	1450	0.049	0.048	4ziqA.pdb.gz
14	PDB:6h03A	0.065	0.070	3.563E-4	1223	0.051	0.058	6h03A.pdb.gz
15	PDB:7q5zA	0.049	0.051	1.270E-3	1344	0.039	0.041	7q5zA.pdb.gz
16	PDB:1igtB	0.051	0.114	3.377E-3	444	0.029	0.090	1igtB.pdb.gz	Refined structure of an intact IgG2a monoclonal antibody.
17	PDB:7nycA	0.057	0.054	6.377E-3	1542	0.047	0.043	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
18	PDB:4rtdA	0.064	0.075	7.032E-3	1122	0.042	0.053	4rtdA.pdb.gz
19	PDB:1mkfA	0.067	0.184	1.147E-2	371	0.034	0.127	1mkfA.pdb.gz
20	PDB:1kiuB	0.028	0.087	1.328E-2	279	0.019	0.097	1kiuB.pdb.gz	Structural basis of tropism of Escherichia coli to the bladder during urinary tract infection.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9Q0B5	0.0	1638	2583	0.561	0.304	E9Q0B5_MOUSE Fc fragment of IgG binding protein OS=Mus musculus OX=10090 GN=Fcgbp PE=1 SV=1
2	E9Q9C6	0.0	1639	2583	0.561	0.304	E9Q9C6_MOUSE Fc fragment of IgG binding protein OS=Mus musculus OX=10090 GN=Fcgbp PE=1 SV=1
3	Q8K0P6	0.0	577	1205	0.240	0.279	Q8K0P6_MOUSE Fcgbp protein (Fragment) OS=Mus musculus OX=10090 GN=Fcgbp PE=2 SV=1
4	Q9Y6R7	0.0	2828	5405	1.000	0.259	FCGBP_HUMAN IgGFc-binding protein OS=Homo sapiens OX=9606 GN=FCGBP PE=1 SV=3
5	Q28983	3.80e-179	591	2476	0.255	0.144	ZAN_PIG Zonadhesin OS=Sus scrofa OX=9823 GN=ZAN PE=1 SV=1
6	O08523	2.97e-177	582	2155	0.244	0.159	TECTA_MOUSE Alpha-tectorin OS=Mus musculus OX=10090 GN=Tecta PE=1 SV=2
7	O75443	3.15e-177	582	2155	0.244	0.158	TECTA_HUMAN Alpha-tectorin OS=Homo sapiens OX=9606 GN=TECTA PE=1 SV=3
8	Q8C5Q6	5.15e-174	523	333	0.174	0.730	Q8C5Q6_MOUSE VWFD domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Fcgbp PE=2 SV=1
9	O88799	2.88e-161	542	5376	0.241	0.063	ZAN_MOUSE Zonadhesin OS=Mus musculus OX=10090 GN=Zan PE=1 SV=1
10	Q8R0K8	1.12e-100	338	657	0.169	0.361	Q8R0K8_MOUSE Fcgbp protein (Fragment) OS=Mus musculus OX=10090 GN=Fcgbp PE=2 SV=1
11	Q58E52	3.95e-89	305	615	0.154	0.350	Q58E52_MOUSE Fcgbp protein (Fragment) OS=Mus musculus OX=10090 GN=Fcgbp PE=2 SV=1
12	Q6IS34	2.02e-85	293	592	0.149	0.351	Q6IS34_MOUSE Fcgbp protein (Fragment) OS=Mus musculus OX=10090 GN=Fcgbp PE=2 SV=1
13	E9QAQ8	8.43e-83	303	3455	0.199	0.081	E9QAQ8_MOUSE Mucin 5, subtypes A and C, tracheobronchial/gastric OS=Mus musculus OX=10090 GN=Muc5ac PE=1 SV=5
14	E9PWB6	4.22e-81	298	2751	0.199	0.101	E9PWB6_MOUSE Mucin 5, subtypes A and C, tracheobronchial/gastric OS=Mus musculus OX=10090 GN=Muc5ac PE=1 SV=1
15	P98088	1.44e-78	290	5654	0.199	0.049	MUC5A_HUMAN Mucin-5AC OS=Homo sapiens OX=9606 GN=MUC5AC PE=1 SV=4
16	E7F9Z1	2.64e-76	283	2812	0.159	0.079	E7F9Z1_DANRE von Willebrand factor OS=Danio rerio OX=7955 GN=VWF PE=1 SV=3
17	Q8BYW0	1.75e-71	266	1477	0.196	0.186	Q8BYW0_MOUSE VWFD domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Muc5b PE=2 SV=1
18	Q9HC84	3.05e-71	267	5762	0.201	0.049	MUC5B_HUMAN Mucin-5B OS=Homo sapiens OX=9606 GN=MUC5B PE=1 SV=3
19	E9Q5I3	7.90e-71	266	4800	0.197	0.058	E9Q5I3_MOUSE Mucin 5, subtype B, tracheobronchial OS=Mus musculus OX=10090 GN=Muc5b PE=1 SV=1
20	Q8K1G6	3.01e-70	264	4782	0.196	0.058	Q8K1G6_MOUSE Muc5b protein OS=Mus musculus OX=10090 GN=Muc5b PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08742 C8	5.1e-35	130.9	C8 domain
2	PF17517 IgGFc_binding	2.5e-55	199.5	IgGFc binding protein
3	PF01826 TIL	4.2e-16	70.2	Trypsin Inhibitor like cysteine rich domain
4	PF12714 TILa	2.9e-09	48.0	TILa domain
5	PF00094 VWD	6.6e-109	372.6	von Willebrand factor type D domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008963216.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008976009.1	0.815	Protein Churchill isoform X1
2	9597.XP_003815806.1	0.735	Neuronal pentraxin-2
3	9597.XP_003823935.1	0.731	Trefoil factor 3
4	9597.XP_003832873.1	0.709	Belongs to the serpin family.
5	9597.XP_008948907.1	0.674	Protocadherin-17 isoform X1
6	9597.XP_003806038.1	0.670	Cadherin related family member 5
7	9597.XP_008952363.1	0.620	Neuronal PAS domain protein 4
8	9597.XP_003828649.1	0.589	N-acetylated-alpha-linked acidic dipeptidase-like protein isoform X1
9	9597.XP_003805349.1	0.566	Calcium-activated chloride channel regulator 1
10	9597.XP_003805351.1	0.566	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 1 base in 1 codon
11	9597.XP_003814014.1	0.563	Complement C1q C chain
12	9597.XP_003804967.1	0.501	N-acylsphingosine amidohydrolase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0005576	0.991	extracellular region
GO:0043227	0.987	membrane-bounded organelle
GO:0071944	0.900	cell periphery
GO:0005615	0.895	extracellular space
GO:0031982	0.780	vesicle
GO:0065010	0.650	extracellular membrane-bounded organelle
GO:0070062	0.619	extracellular exosome
GO:0031012	0.454	extracellular matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]