StarFunc result for job id Q9Y6U3

User Input

>input (715 residues)
MARELYHEEFARAGKQAGLQVWRIEKLELVPVPQSAHGDFYVGDAYLVLHTAKTSRGFTY
HLHFWLGKECSQDESTAAAIFTVQMDDYLGGKPVQNRELQGYESNDFVSYFKGGLKYKAG
GVASGLNHVLTNDLTAKRLLHVKGRRVVRATEVPLSWDSFNKGDCFIIDLGTEIYQWCGS
SCNKYERLKANQVATGIRYNERKGRSELIVVEEGSEPSELIKVLGEKPELPDGGDDDDII
ADISNRKMAKLYMVSDASGSMRVTVVAEENPFSMAMLLSEECFILDHGAAKQIFVWKGKD
ANPQERKAAMKTAEEFLQQMNYSKNTQIQVLPEGGETPIFKQFFKDWRDKDQSDGFGKVY
VTEKVAQIKQIPFDASKLHSSPQMAAQHNMVDDGSGKVEIWRVENNGRIQVDQNSYGEFY
GGDCYIILYTYPRGQIIYTWQGANATRDELTTSAFLTVQLDRSLGGQAVQIRVSQGKEPV
HLLSLFKDKPLIIYKNGTSKKGGQAPAPPTRLFQVRRNLASITRIVEVDVDANSLNSNDV
FVLKLPQNSGYIWVGKGASQEEEKGAEYVASVLKCKTLRIQEGEEPEEFWNSLGGKKDYQ
TSPLLETQAEDHPPRLYGCSNKTGRFVIEEIPGEFTQDDLAEDDVMLLDAWEQIFIWIGK
DANEVEKKESLKSAKMYLETDPSGRDKRTPIVIIKQGHEPPTFTGWFLGWDSSKW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PU64	0.546	0.546	0.000	715	0.917	0.917	E9PU64.pdb.gz	E9PU64_RAT Scinderin OS=Rattus norvegicus OX=10116 GN=Scin PE=1 SV=1
2	AFDB:Q5ZIV9	0.569	0.567	0.000	717	0.806	0.803	Q5ZIV9.pdb.gz	SCIN_CHICK Scinderin OS=Gallus gallus OX=9031 GN=SCIN PE=2 SV=2
3	AFDB:P06396	0.509	0.469	2.475E-101	782	0.601	0.550	P06396.pdb.gz	GELS_HUMAN Gelsolin OS=Homo sapiens OX=9606 GN=GSN PE=1 SV=1
4	AFDB:A0A0R4IQ11	0.588	0.585	3.550E-99	720	0.585	0.581	A0A0R4IQ11.pdb.gz
5	PDB:6jegB	0.491	0.489	2.372E-96	718	0.597	0.595	6jegB.pdb.gz
6	AFDB:O88398	0.491	0.448	2.300E-91	819	0.487	0.425	O88398.pdb.gz	AVIL_MOUSE Advillin OS=Mus musculus OX=10090 GN=Avil PE=1 SV=2
7	AFDB:P09327	0.501	0.443	4.459E-91	827	0.474	0.410	P09327.pdb.gz	VILI_HUMAN Villin-1 OS=Homo sapiens OX=9606 GN=VIL1 PE=1 SV=4
8	AFDB:O75366	0.488	0.431	2.439E-87	819	0.487	0.425	O75366.pdb.gz	AVIL_HUMAN Advillin OS=Homo sapiens OX=9606 GN=AVIL PE=1 SV=3
9	AFDB:O15195	0.443	0.375	4.524E-75	856	0.385	0.321	O15195.pdb.gz	VILL_HUMAN Villin-like protein OS=Homo sapiens OX=9606 GN=VILL PE=1 SV=3
10	AFDB:Q07171	0.487	0.439	9.977E-70	798	0.362	0.325	Q07171.pdb.gz	GELS_DROME Gelsolin OS=Drosophila melanogaster OX=7227 GN=Gel PE=1 SV=2
11	AFDB:O81644	0.470	0.353	8.836E-67	976	0.327	0.240	O81644.pdb.gz	VILI2_ARATH Villin-2 OS=Arabidopsis thaliana OX=3702 GN=VLN2 PE=1 SV=2
12	PDB:1j72A	0.145	0.299	3.826E-41	337	0.241	0.510	1j72A.pdb.gz
13	PDB:7cccB	0.117	0.225	1.902E-6	342	0.050	0.105	7cccB.pdb.gz	The structure of the actin filament uncapping complex mediated by twinfilin.
14	PDB:1m2vA	0.107	0.109	8.688E-4	705	0.052	0.052	1m2vA.pdb.gz	Structure of the Sec23/24-Sar1 pre-budding complex of the COPII vesicle coat
15	PDB:5kynA	0.121	0.119	3.854E-3	730	0.057	0.056	5kynA.pdb.gz	TANGO1/cTAGE5 receptor as a polyvalent template for assembly of large COPII coats.
16	PDB:2i2qA	0.102	0.420	9.845E-3	122	0.017	0.098	2i2qA.pdb.gz
17	PDB:1udmA	0.098	0.387	1.228E-2	149	0.014	0.067	1udmA.pdb.gz
18	PDB:5cskA	0.093	0.038	1.371E-2	1996	0.073	0.026	5cskA.pdb.gz
19	PDB:5cskB	0.082	0.038	1.909E-2	2017	0.080	0.028	5cskB.pdb.gz
20	PDB:6g2dC	0.087	0.038	2.132E-2	2121	0.087	0.029	6g2dC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0JMJ1	0.0	885	720	0.585	0.581	A0JMJ1_DANRE Scinderin like a OS=Danio rerio OX=7955 GN=fb94b12 PE=1 SV=2
2	E9PU64	0.0	1388	715	0.919	0.919	E9PU64_RAT Scinderin OS=Rattus norvegicus OX=10116 GN=Scin PE=1 SV=1
3	G1U9R8	0.0	933	739	0.603	0.583	G1U9R8_RABIT Gelsolin OS=Oryctolagus cuniculus OX=9986 GN=GSN PE=3 SV=3
4	O75366	0.0	692	819	0.497	0.433	AVIL_HUMAN Advillin OS=Homo sapiens OX=9606 GN=AVIL PE=1 SV=3
5	O88398	0.0	672	819	0.491	0.429	AVIL_MOUSE Advillin OS=Mus musculus OX=10090 GN=Avil PE=1 SV=2
6	P06396	0.0	934	782	0.603	0.551	GELS_HUMAN Gelsolin OS=Homo sapiens OX=9606 GN=GSN PE=1 SV=1
7	P09327	0.0	679	827	0.477	0.412	VILI_HUMAN Villin-1 OS=Homo sapiens OX=9606 GN=VIL1 PE=1 SV=4
8	P13020	0.0	926	780	0.596	0.546	GELS_MOUSE Gelsolin OS=Mus musculus OX=10090 GN=Gsn PE=1 SV=3
9	P20305	0.0	932	772	0.599	0.554	GELS_PIG Gelsolin (Fragment) OS=Sus scrofa OX=9823 GN=GSN PE=1 SV=1
10	Q28046	0.0	1390	715	0.920	0.920	SCIN_BOVIN Scinderin OS=Bos taurus OX=9913 GN=SCIN PE=1 SV=1
11	Q5ZIV9	0.0	1243	717	0.807	0.805	SCIN_CHICK Scinderin OS=Gallus gallus OX=9031 GN=SCIN PE=2 SV=2
12	Q60604	0.0	1385	715	0.915	0.915	SCIN_MOUSE Scinderin OS=Mus musculus OX=10090 GN=Scin PE=1 SV=3
13	Q62468	0.0	682	827	0.480	0.415	VILI_MOUSE Villin-1 OS=Mus musculus OX=10090 GN=Vil1 PE=1 SV=3
14	Q68FP1	0.0	926	780	0.600	0.550	GELS_RAT Gelsolin OS=Rattus norvegicus OX=10116 GN=Gsn PE=1 SV=1
15	Q7TQ08	0.0	1386	715	0.916	0.916	Q7TQ08_RAT Scinderin OS=Rattus norvegicus OX=10116 GN=Scin PE=2 SV=1
16	Q9WU06	0.0	677	819	0.498	0.435	AVIL_RAT Advillin OS=Rattus norvegicus OX=10116 GN=Avil PE=2 SV=2
17	Q9Y6U3	0.0	1486	715	1.000	1.000	SCIN_HUMAN Scinderin OS=Homo sapiens OX=9606 GN=SCIN PE=1 SV=4
18	O15195	6.75e-167	503	856	0.396	0.331	VILL_HUMAN Villin-like protein OS=Homo sapiens OX=9606 GN=VILL PE=1 SV=3
19	B4DV78	4.90e-138	417	516	0.283	0.391	B4DV78_HUMAN Villin 1 OS=Homo sapiens OX=9606 GN=VIL1 PE=1 SV=1
20	Q07171	1.45e-127	399	798	0.379	0.340	GELS_DROME Gelsolin OS=Drosophila melanogaster OX=7227 GN=Gel PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03091 CutA1	2.5e+02	12.9	CutA1 divalent ion tolerance protein
2	PF00626 Gelsolin	6.6e-94	319.2	Gelsolin repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000297029

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000245907	0.947	Complement C3
2	9606.ENSP00000362924	0.809	Gelsolin
3	9606.ENSP00000259365	0.671	Tropomodulin-1
4	9606.ENSP00000264012	0.667	Cadherin-3
5	9606.ENSP00000260843	0.656	G-protein coupled receptor 87
6	9606.ENSP00000171757	0.652	Putative P2Y purinoceptor 10
7	9606.ENSP00000249396	0.650	NAD-dependent protein deacetylase sirtuin-2
8	9606.ENSP00000371194	0.644	Lymphocyte-specific protein 1
9	9606.ENSP00000249700	0.639	Tropomodulin-2
10	9606.ENSP00000264380	0.631	1-phosphatidylinositol 3-phosphate 5-kinase
11	9606.ENSP00000296046	0.611	M14 carboxypeptidases
12	9606.ENSP00000265382	0.608	Phosphatidylinositol 4-phosphate 5-kinase type-1 beta
13	9606.ENSP00000347032	0.608	Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma
14	9606.ENSP00000357883	0.608	Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha
15	9606.ENSP00000365757	0.608	Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha
16	9606.ENSP00000466363	0.608	Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma
17	9606.ENSP00000482548	0.608	Phosphatidylinositol 5-phosphate 4-kinase type-2 beta
18	9606.ENSP00000481109	0.601	Catalytically inactive protein kinase that acts as a scaffold protein. Functions as an effector of the small GTPase RND2, which stimulates RhoA activity and inhibits NGF-induced neurite outgrowth (By similarity). Promotes Src family kinase (SFK) signaling by regulating the subcellular localization of CSK, a negative regulator of these kinases, leading to the regulation of cell morphology and motility by a CSK-dependent mechanism (By similarity). Acts as a critical coactivator of Notch signaling (By similarity)
19	9606.ENSP00000385828	0.599	Thiosulfate sulfurtransferase
20	9606.ENSP00000345968	0.595	N-acetylmuramoyl-L-alanine amidase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003779	1.000	actin binding
GO:0046872	0.997	metal ion binding
GO:0035091	0.995	phosphatidylinositol binding
GO:0005509	0.993	calcium ion binding
GO:0044877	0.938	protein-containing complex binding
GO:0005545	0.721	1-phosphatidylinositol binding
GO:0051015	0.673	actin filament binding
GO:0019899	0.374	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050794	0.988	regulation of cellular process
GO:0044087	0.920	regulation of cellular component biogenesis
GO:0048518	0.905	positive regulation of biological process
GO:0030029	0.899	actin filament-based process
GO:0043244	0.887	regulation of protein-containing complex disassembly
GO:0033043	0.885	regulation of organelle organization
GO:1902903	0.879	regulation of supramolecular fiber organization
GO:0048519	0.867	negative regulation of biological process
GO:0016043	0.862	cellular component organization
GO:0048523	0.848	negative regulation of cellular process
GO:0051493	0.790	regulation of cytoskeleton organization
GO:0065008	0.787	regulation of biological quality
GO:0043242	0.757	negative regulation of protein-containing complex disassembly
GO:0090066	0.732	regulation of anatomical structure size
GO:0048522	0.726	positive regulation of cellular process
GO:0051179	0.723	localization
GO:0032970	0.719	regulation of actin filament-based process
GO:0006996	0.695	organelle organization
GO:0050896	0.688	response to stimulus
GO:1901879	0.662	regulation of protein depolymerization
GO:0110053	0.652	regulation of actin filament organization
GO:0043254	0.633	regulation of protein-containing complex assembly
GO:0010639	0.632	negative regulation of organelle organization
GO:0007015	0.630	actin filament organization
GO:0032271	0.603	regulation of protein polymerization
GO:1902904	0.596	negative regulation of supramolecular fiber organization
GO:0051494	0.596	negative regulation of cytoskeleton organization
GO:0051239	0.592	regulation of multicellular organismal process
GO:0030834	0.574	regulation of actin filament depolymerization
GO:1901880	0.572	negative regulation of protein depolymerization
GO:0030835	0.562	negative regulation of actin filament depolymerization
GO:0030837	0.560	negative regulation of actin filament polymerization
GO:0051693	0.548	actin filament capping
GO:0050793	0.495	regulation of developmental process
GO:2000026	0.405	regulation of multicellular organismal development
GO:0032501	0.332	multicellular organismal process
GO:0048856	0.317	anatomical structure development
GO:0019222	0.310	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.996	membrane-bounded organelle
GO:0071944	0.992	cell periphery
GO:0005576	0.976	extracellular region
GO:0005737	0.975	cytoplasm
GO:0032991	0.967	protein-containing complex
GO:0005615	0.908	extracellular space
GO:0070062	0.885	extracellular exosome
GO:0043229	0.880	intracellular organelle
GO:0016020	0.843	membrane
GO:0005829	0.797	cytosol
GO:0043231	0.785	intracellular membrane-bounded organelle
GO:0005886	0.423	plasma membrane
GO:0043232	0.393	intracellular non-membrane-bounded organelle
GO:0005856	0.323	cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]